# Peptide Research — Full Corpus Generated: 2026-05-10T23:23:13.544Z This file contains the full text of every peptide profile and every article on peptide-research.org, concatenated as plain markdown for LLM ingestion. The canonical site is https://peptide-research.org. --- # Peptide Profiles # Peptide: 5-Amino-1MQ URL: https://peptide-research.org/directory/5-amino-1mq Category: Longevity Status: Research compound Last reviewed: 2026-04-17 Aliases: 5-amino-1-methylquinolinium, NNMT inhibitor Compound class: Small molecule Summary: A small-molecule compound that researchers and self-experimenters study for its effects on metabolism, body composition, cellular energy, and healthy aging. Often discussed as a tool for understanding and potentially optimizing metabolic flexibility through NNMT inhibition. ## Overview **It’s completely reasonable — and intelligent — to be curious about 5-Amino-1MQ.** This small molecule isn’t a peptide — it’s a synthetic compound designed to inhibit an enzyme called **NNMT** (nicotinamide N-methyltransferase). It’s frequently discussed in longevity, metabolic optimization, and biohacking communities because it targets fundamental pathways involved in how our bodies handle energy, fat storage, cellular repair, and healthy aging. The appeal is straightforward: many people want better metabolic flexibility, healthier body composition, sustained energy levels, and to take a more active role in supporting their healthspan. 5-Amino-1MQ represents one fascinating research avenue for exploring these goals through a specific, well-defined biological mechanism. ## The Science: Understanding NNMT Think of NNMT as a cellular "methyl group consumer." It takes a methyl donor called SAM (S-adenosyl methionine) and uses it to methylate nicotinamide (a form of vitamin B3). This process produces 1-methylnicotinamide (1-MNA). When NNMT activity is elevated — which research suggests happens in obesity, metabolic dysfunction, and aging — several things occur: - **Methyl group depletion**: Your cells burn through methyl donors faster than ideal - **Reduced NAD+ availability**: Important for cellular energy and repair - **Altered fat metabolism**: Changes in how adipose tissue stores vs burns energy - **Potential effects on muscle stem cells**: Impact on tissue maintenance and regeneration 5-Amino-1MQ acts as a selective NNMT inhibitor. By reducing this enzyme's activity, preclinical research suggests it may help: - Preserve cellular methyl pools - Support NAD+ levels - Shift adipose tissue toward healthier metabolic function - Support muscle stem cell activity ## What Researchers Have Observed (Preclinical) The current body of evidence comes primarily from rodent studies: - **Body Composition**: In diet-induced obesity models, NNMT inhibition has been associated with reduced fat mass and improved insulin sensitivity — notably without requiring caloric restriction in some studies. - **Metabolic Health**: Improvements in glucose tolerance, lipid profiles, and hepatic fat content have been reported. - **Muscle Health**: Research in aged mice suggests potential benefits for skeletal muscle stem cell function and regeneration capacity (relevant to sarcopenia research). - **Cellular Energy**: Effects on NAD+ biology and methylation capacity — two areas heavily studied in longevity research. These findings are mechanistically interesting because they touch on fundamental aging and metabolic pathways that many researchers believe are worth understanding better. ## The Empowerment Angle: Quality of Life Research Many people researching 5-Amino-1MQ aren't looking for a "magic pill." They're exploring it as part of a broader commitment to: - **Understanding their own metabolism** rather than accepting generic advice - **Optimizing body composition** while preserving muscle (a common challenge with many interventions) - **Supporting sustained energy and metabolic flexibility** - **Taking an active role in their healthspan** rather than being passive about aging - **Contributing to citizen science** by carefully documenting their experiences The philosophy here is one of informed self-experimentation. By learning about the underlying biology (methylation, NAD+, adipose tissue function, muscle stem cells), people feel more equipped to make decisions about their health. ## State of the Evidence (Be Realistically Hopeful) **Important context**: The research is still early. - Almost entirely preclinical (cell and rodent studies) - No published Phase 1 human safety trials or detailed pharmacokinetic data in peer-reviewed literature - Human translation of the impressive rodent findings remains an open question - Long-term safety data in humans is not yet available This doesn't mean the research is invalid — it means we're in the "understanding the mechanism and exploring potential" phase. Many people in the research community view compounds like 5-Amino-1MQ as valuable tools for learning about human metabolism, even if clinical applications are years away. ## Approaching Research Responsibly If you're considering researching this compound, the most empowered approach combines curiosity with responsibility: 1. **Learn the biology first** — Understanding NNMT, methylation cycles, NAD+ pathways, and metabolic flexibility gives you context for what you're observing 2. **Set clear, measurable outcomes** — What specifically are you hoping to learn or improve? (body composition, fasting glucose, energy levels, exercise recovery, blood markers, etc.) 3. **Start conservatively** with thorough documentation — many researchers track sleep, training, nutrition, and subjective energy alongside objective metrics 4. **Build on strong foundations** — sleep, resistance training, adequate protein, stress management, and proper nutrition remain the primary drivers of metabolic health 5. **View it as educational research** — the goal is both potential personal insight *and* better understanding of your own unique biology The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry was rewritten to help you understand both the science *and* the human motivation behind researching 5-Amino-1MQ. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Neelakantan H et al. Selective and membrane-permeable small molecule inhibitors of NNMT — (2017) doi:10.1016/j.bmcl.2017.06.045 - Kannt A et al. A small molecule inhibitor of NNMT for the treatment of metabolic disorders — (2018) doi:10.1038/s41598-018-21902-z - Pissios P. Nicotinamide N-Methyltransferase: more than a vitamin B3 clearance enzyme — (2017) doi:10.1016/j.tem.2017.02.004 --- # Peptide: ACE-031 URL: https://peptide-research.org/directory/ace-031 Category: Growth Hormone Status: Investigational Last reviewed: 2026-05-10 Aliases: ActRIIB-Fc, ACVR2B-Fc Compound class: Fusion protein Summary: An investigational soluble activin receptor type IIB fusion protein studied for blocking myostatin-family ligands and increasing muscle mass in wasting disorders. ## Overview ACE-031 is not a simple peptide. It is a soluble activin receptor type IIB fusion protein designed to bind ligands such as myostatin and related TGF-beta family members. ## The Science The target is the muscle-growth brake system. Blocking myostatin-family signaling can increase muscle mass in animal models and some human research settings, but pathway breadth creates safety questions. - **Myostatin inhibition** - reduces one negative regulator of muscle growth. - **Activin signaling** - broader than myostatin alone, which affects risk interpretation. - **Muscle-wasting research** - studied in neuromuscular and cachexia-related contexts. ## Evidence Snapshot ACE-031 is a high-impact pathway intervention, not a general fitness peptide. Muscle size, function, vascular findings, and off-target TGF-beta-family effects all matter. > **Important Context** > > Myostatin-pathway agents can look simple in marketing, but the biology is broad. More muscle mass is not the only endpoint that matters. --- # Peptide: Adamax URL: https://peptide-research.org/directory/adamax Category: Cognitive Status: Research compound Last reviewed: 2026-05-10 Aliases: Adamax peptide, Semax-derived nootropic peptide Summary: A Semax-derived cognitive research peptide marketed in nootropic communities, with claims centered on neurotrophic signaling, focus, mood, and stress resilience. ## Overview Adamax is a Semax-derived peptide product discussed in nootropic and cognitive-enhancement communities. It should be treated as a research-market analog rather than an approved cognitive medicine. ## The Science The product is usually framed through the same broad themes as Semax: ACTH-fragment lineage, neurotrophic signaling, stress resilience, and cognitive performance. - **Semax lineage** - comparison with the [Semax profile](/directory/semax) is the right starting point. - **Neurotrophic claims** - often discussed around BDNF and related pathways. - **Nootropic uncertainty** - user reports are not a substitute for controlled trials. ## Evidence Snapshot Adamax has much less accessible clinical evidence than Semax itself. Product identity, purity, route, and comparison with better-characterized Semax formulations are central. > **Research Lens** > > For Adamax, start with Semax literacy, then ask what modification is being claimed and whether evidence exists for that exact analog. --- # Peptide: Adipotide URL: https://peptide-research.org/directory/adipotide Category: Metabolic Status: Research compound Last reviewed: 2026-05-10 Aliases: FTTP, Prohibitin-targeting peptide Summary: An experimental peptidomimetic studied preclinically for targeting adipose vasculature through prohibitin-related mechanisms, with major translational and safety uncertainty. ## Overview Adipotide, also called FTTP, is an experimental compound designed to target blood vessels supplying white adipose tissue. It is not a standard metabolic peptide like GLP-1 drugs. ## The Science The research concept is vascular targeting: interfere with adipose tissue support structures rather than directly modulating appetite hormones. - **Adipose vasculature** - proposed targeting of blood supply to fat tissue. - **Prohibitin-related binding** - often described as part of the targeting logic. - **Preclinical obesity models** - much of the attention comes from animal research. ## Evidence Snapshot Adipotide remains a high-uncertainty research compound. The mechanism is aggressive compared with nutrient or incretin approaches, so safety and translation questions are central. > **Important Context** > > Adipose vascular targeting is not equivalent to ordinary weight-management pharmacology. Treat claims as preclinical unless a specific human study supports them. --- # Peptide: AICAR URL: https://peptide-research.org/directory/aicar Category: Metabolic Status: Research compound Last reviewed: 2026-05-10 Aliases: Acadesine, AICA ribonucleotide, ZMP Compound class: Nucleotide analog Summary: A nucleotide analog and AMPK-pathway research tool studied in cellular energy sensing, exercise-mimetic biology, cardiometabolic research, and anti-doping contexts. ## Overview AICAR is not a peptide. It is a nucleotide analog that can be converted intracellularly to ZMP, an AMP mimic that activates AMPK-related energy-sensing pathways. ## The Science AMPK is often described as a cellular fuel gauge. AICAR is studied because it can push that system in experimental models. - **Energy sensing** - AMPK activation under low-energy-like conditions. - **Metabolic research** - glucose uptake, lipid oxidation, and mitochondrial adaptation models. - **Exercise-mimetic biology** - often discussed because some animal studies mimic endurance-training signals. - **Anti-doping context** - AICAR is relevant to performance-enhancement screening. ## Evidence Snapshot AICAR is best treated as a laboratory pathway tool, not a proven human performance or fat-loss product. Mechanistic AMPK activation does not equal safe metabolic enhancement. > **Research Lens** > > For AICAR, the main question is whether a pathway signal observed in models translates to meaningful and safe outcomes in humans. --- # Peptide: AOD-9604 URL: https://peptide-research.org/directory/aod-9604 Category: Metabolic Status: Research compound Last reviewed: 2026-04-17 Aliases: HGH Fragment 176-191, Anti-Obesity Drug 9604 Sequence: YLRIVQCRSVEGSCGF Summary: A synthetic fragment of growth hormone designed to isolate GH's fat-mobilizing effects without its growth-promoting or blood-sugar-altering activity — a tool researchers and self-experimenters study for body composition and joint health. ## Overview **It's completely reasonable — and intelligent — to be curious about AOD-9604.** > **Educational Note** > > Wanting to understand your own body composition, energy, and the levers that influence fat metabolism is one of the most useful forms of self-education there is. AOD-9604 is interesting precisely because it tries to isolate a single, specific slice of growth-hormone biology — and studying it teaches you a lot about how the body partitions fat and fuel. AOD-9604 ("Anti-Obesity Drug 9604") is a synthetic 16-amino-acid peptide corresponding to residues 176–191 of the C-terminus of human growth hormone (hGH). It was developed by Metabolic Pharmaceuticals in the late 1990s and early 2000s on the hypothesis that the *lipolytic* (fat-mobilizing) activity of GH could be separated from its growth-promoting and glucose-altering effects in a shorter fragment. The appeal is straightforward: many people researching AOD-9604 aren't chasing a magic pill — they want to understand how fat is mobilized and stored, and whether a GH-derived fragment can support body composition work without the broader hormonal footprint of full-length GH. ## The Science: Isolating GH's Lipolytic Tail Think of growth hormone as a multifunctional signal — it drives growth, shifts glucose handling, and mobilizes fat from adipose tissue. AOD-9604 represents an attempt to keep only the "mobilize fat" piece. Research describes several mechanisms: - **Lipolytic activity** in adipose tissue, proposed to act via stimulation of β3-adrenergic signaling in fat cells. - **No direct activation of the GH receptor** at typical research doses — setting it apart from full-length GH or GH secretagogues. - **Minimal effect on IGF-1** in published human studies, in contrast to GH or GHRH analogs. - **Cartilage and chondrocyte effects** explored in more recent preclinical and Phase 2 studies. This is conceptually elegant — instead of activating the whole GH cascade, you're nudging a specific downstream node. ## What Researchers Have Observed - **Fat loss and obesity.** AOD-9604 was advanced through Phase 2b trials in obesity, with reports of modest reductions in body weight and fat mass versus placebo, though it did not reach commercialization. - **Osteoarthritis.** A later Phase 2 program examined intra-articular AOD-9604 for knee osteoarthritis, reporting improvements in pain and function in some studies. - **Cartilage repair.** Preclinical work has examined effects on chondrocyte biology and cartilage regeneration. - **Metabolic markers.** Studies have looked at lipid profiles and insulin sensitivity alongside weight endpoints. The findings are more modest than marketing often suggests, but the dissociation of lipolysis from IGF-1 effects is scientifically meaningful. ## The Empowerment Angle: Quality of Life Research Many people researching AOD-9604 aren't looking for a shortcut. They're exploring it as part of: - **Understanding fat metabolism** — learning how adipose tissue actually releases stored energy - **Targeted body composition work** alongside training, nutrition, and sleep - **Curiosity about GH biology** without the broader effects of full GH or secretagogues - **Taking an active role in healthspan** rather than passively accepting metabolic drift - **Citizen science** — carefully documenting their experience alongside blood markers and body metrics The philosophy is informed self-experimentation grounded in understanding *why* a specific fragment of GH might behave differently than the full hormone. ## State of the Evidence **Important context**: AOD-9604 has a Phase 2 human safety record from the Metabolic Pharmaceuticals program, with tolerability comparable to placebo in obesity trials. It did not progress to approval, and the obesity program was eventually shelved. Current research interest is primarily in musculoskeletal indications and as a research tool for dissecting GH's lipolytic activity from its anabolic and glycemic effects. - Human efficacy data for body-composition outcomes are modest - It has GRAS status in Australia in some contexts but varies by jurisdiction - Independent replications of the most striking preclinical fat-loss findings are limited This doesn't make the research uninteresting — it's a tool for understanding how fat mobilization can be targeted with specificity, even if the clinical story is still incomplete. ## Approaching Research Responsibly If you're considering researching this compound, the most empowered approach combines curiosity with rigor: > **Practical Framework** > > 1. **Learn the biology first** — Understanding adipose tissue, β-adrenergic signaling, GH's full effects, and why isolating lipolysis might matter gives you context for what you're observing > 2. **Set clear, measurable outcomes** — body composition (DEXA, calipers), waist measurements, energy, training performance, fasting glucose, lipid panels > 3. **Start conservatively with thorough documentation** — track sleep, training, nutrition, and subjective energy alongside objective metrics > 4. **Build on strong foundations** — training, protein intake, sleep, and caloric balance remain the primary drivers of body composition > 5. **View it as educational research** — the goal is insight into your own metabolism, not shortcut outcomes The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry was rewritten to help you understand both the science and the human motivation behind researching AOD-9604. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Ng FM, Bornstein J. Hyperglycemic action of synthetic C-terminal fragments of human growth hormone — (1978) doi:10.1016/0003-9861(78)90194-0 - Heffernan M et al. The effects of human GH and its lipolytic fragment (AOD9604) on lipid metabolism — (2001) doi:10.1210/endo.142.12.8549 - Kwon DR, Park GY. Effect of AOD-9604 on knee osteoarthritis — (2015) --- # Peptide: ARA-290 URL: https://peptide-research.org/directory/ara-290 Category: Healing & Recovery Status: Investigational Last reviewed: 2026-05-10 Aliases: Cibinetide, Helix B surface peptide Summary: An erythropoietin-derived peptide studied for tissue-protective and anti-inflammatory signaling without the red-blood-cell stimulation associated with EPO. ## Overview ARA-290, also called cibinetide, is a peptide derived from the tissue-protective region of erythropoietin biology. It is designed to avoid EPO's red-blood-cell-stimulating effects. ## The Science The research focus is tissue protection and inflammation modulation rather than erythropoiesis. - **Innate repair receptor signaling** - proposed tissue-protective pathway. - **Neuropathy research** - studied in small-fiber neuropathy and pain-related contexts. - **Inflammation resolution** - interest in immune and vascular repair signaling. ## Evidence Snapshot ARA-290 has human research history but remains investigational. It should not be confused with EPO or interpreted as a red-blood-cell boosting compound. > **Research Lens** > > ARA-290 is interesting precisely because it separates some EPO-like tissue-protection ideas from erythropoiesis. --- # Peptide: B12 URL: https://peptide-research.org/directory/b12 Category: Longevity Status: FDA-approved Last reviewed: 2026-05-10 Aliases: Vitamin B12, Cobalamin, Methylcobalamin, Cyanocobalamin Compound class: Vitamin Summary: An essential water-soluble vitamin required for red blood cell formation, nervous-system function, DNA synthesis, and one-carbon metabolism; it is not a peptide. ## Overview B12 is vitamin B12, a cobalamin vitamin. It is included here only because injectable B12 is frequently marketed beside peptides and lipotropic blends. ## The Science Vitamin B12 is required for neurologic function, red blood cell formation, DNA synthesis, and methylation-related metabolism. - **Deficiency treatment** - strong evidence when deficiency or malabsorption is present. - **Nervous system** - myelination and neurologic function. - **Methylation markers** - methylmalonic acid and homocysteine can help interpret status. ## Evidence Snapshot B12 is essential, but supplementation claims depend on baseline status. Correcting deficiency is different from enhancement in a replete person. > **Research Lens** > > For B12, baseline status changes the whole interpretation. Serum B12, MMA, and clinical context matter. ## Citations - NIH Office of Dietary Supplements. Vitamin B12 fact sheet for health professionals — (2024) https://ods.od.nih.gov/factsheets/VitaminB12-HealthProfessional/ --- # Peptide: Botulinum Toxin URL: https://peptide-research.org/directory/botulinum-toxin Category: Healing & Recovery Status: FDA-approved Last reviewed: 2026-05-10 Aliases: Botox, OnabotulinumtoxinA, BoNT Compound class: Protein toxin Summary: A bacterial neurotoxin protein used clinically in tightly controlled doses for neuromuscular, migraine, autonomic, and cosmetic indications; it is not a peptide supplement. ## Overview Botulinum toxin is a protein neurotoxin produced by Clostridium botulinum. Pharmaceutical botulinum toxin products are used in extremely controlled doses for specific medical and cosmetic indications. ## The Science Botulinum toxin blocks acetylcholine release at neuromuscular junctions and certain autonomic nerve terminals. That local interruption of neurotransmitter release explains both therapeutic effects and serious risks. - **Neuromuscular effects** - temporary chemodenervation of targeted muscles. - **Migraine and pain research** - studied in specific chronic migraine protocols. - **Autonomic uses** - sweat glands and other cholinergic targets. - **Cosmetic use** - reduction of dynamic facial lines through local muscle relaxation. ## Evidence Snapshot Botulinum toxin has strong regulated clinical evidence for approved products and indications. That evidence does not generalize to unverified toxins, casual dosing, or nonmedical sourcing. > **Important Context** > > This is a potent neurotoxin. Product identity, dose, injector skill, dilution, and indication are not optional details. --- # Peptide: BPC-157 URL: https://peptide-research.org/directory/bpc-157 Category: Healing & Recovery Status: Research compound Last reviewed: 2026-04-17 Aliases: Body Protection Compound 157, PL 14736 Sequence: GEPPPGKPADDAGLV Summary: A stable 15-amino-acid peptide fragment derived from a protein in human gastric juice, widely studied in preclinical models for tissue protection and repair across gut, tendon, muscle, and vascular tissue. ## Overview **It's completely reasonable — and intelligent — to be curious about BPC-157.** > **Educational Note** > > Wanting to recover faster from injury, to support gut health, and to understand how the body repairs itself is a deeply intelligent form of self-care. BPC-157 sits at the intersection of several fascinating biological pathways — and studying it teaches you a lot about how tissues actually heal. BPC-157 is a synthetic 15-amino-acid fragment derived from a larger protein, "Body Protection Compound," identified in human gastric juice by a research group in Zagreb. Its unusual stability in gastric acid — rare for a peptide — has made it a sustained subject of research interest in tissue protection and repair. The appeal is straightforward: many people researching BPC-157 aren't chasing miracle cures. They're dealing with chronic tendon issues, gut discomfort, slow-to-heal soft-tissue injuries, or simply want to understand whether a peptide this stable can meaningfully support recovery. ## The Science: A Signal for Repair Think of BPC-157 as a *pro-repair signal* — it doesn't replace any single growth factor, but it appears to nudge multiple systems involved in tissue healing in the same direction at once. Published rodent studies describe several overlapping mechanisms: - **Angiogenesis.** Upregulation of VEGFR2 expression and downstream signaling, promoting new blood vessel formation at injury sites — blood supply is foundational to tissue repair. - **Nitric oxide system.** Modulation of the nitric oxide synthase pathway, linking BPC-157 to vascular tone and inflammatory signaling. - **Growth factor crosstalk.** Reported effects on FGF, EGF, and growth hormone receptor pathways in injured tissue. - **Neurotransmitter interaction.** Modulation of dopaminergic and serotonergic systems in rodent models, suggested to mediate gut-brain-axis effects. The interesting property is its *stability* — most peptides are shredded by stomach acid in minutes. BPC-157 is derived from a protein that evolved in exactly that environment. ## What Researchers Have Observed - **Gastrointestinal protection.** The original research program focused on gastric ulcer protection; later rodent studies extended the work to colitis, esophagitis, and protection against NSAID-induced gut injury. - **Tendon and ligament repair.** Rat Achilles transection studies and medial collateral ligament injury models have reported accelerated healing and improved biomechanical properties. - **Muscle healing.** Rodent models of muscle crush and transection show faster functional recovery and reduced fibrosis. - **Vascular repair.** Vascular injury and ischemia models show protective effects, linked to the angiogenic mechanism above. - **Emerging interest.** Preclinical exploration continues in peripheral nerve injury, bone healing, and gut-brain-axis signaling. ## The Empowerment Angle: Quality of Life Research Many people researching BPC-157 aren't looking for a miracle. They're exploring it as part of: - **Understanding the body's repair processes** rather than accepting "just rest it" - **Supporting recovery from tendon and soft-tissue issues** that have resisted conventional care - **Exploring gut health** as a foundation of broader wellbeing - **Taking an active role in how they age and recover** rather than passively accepting wear-and-tear - **Contributing to citizen science** by carefully documenting their experience The philosophy is informed self-experimentation — learning the mechanisms so you can interpret what you observe. ## State of the Evidence **Important context**: The body of evidence is substantial in rodents but sparse in humans. - Most published studies come from a small number of laboratories — primarily the original Zagreb group and their collaborators - Formal Phase 2/3 clinical trials have not been completed - A compounded oral form (PL 14736) was examined in early-phase trials for inflammatory bowel disease - Independent replication outside the core research groups remains limited This doesn't invalidate the work — it means we're still in the "understanding mechanism and exploring potential" phase. BPC-157 is a valuable research tool for learning how tissue repair is coordinated, even as the human clinical picture continues to develop. Note that it appears on the WADA Prohibited List, relevant for competitive athletes. ## Approaching Research Responsibly If you're considering researching this compound, the most empowered approach combines curiosity with rigor: > **Practical Framework** > > 1. **Learn the biology first** — Understanding angiogenesis, tendon healing physiology, and gut mucosal biology gives you context for interpreting your own experience > 2. **Set clear, measurable outcomes** — tendon pain scales, range of motion, specific functional tests, gut symptom diaries, or healing timelines > 3. **Start conservatively with thorough documentation** — track sleep, training load, nutrition, and pain alongside objective measures > 4. **Build on strong foundations** — progressive loading for tendons, adequate protein, sleep, and sensible training remain the primary drivers of repair > 5. **View it as educational research** — the goal is insight into your own healing biology, not a shortcut around rehabilitation work The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry was rewritten to help you understand both the science and the human motivation behind researching BPC-157. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Sikiric P et al. Stable gastric pentadecapeptide BPC 157 and wound healing — (2018) doi:10.2174/1381612825666181129110005 - Staresinic M et al. BPC-157 accelerates Achilles tendon healing in rats — (2003) doi:10.1016/S0736-0266(03)00099-9 - Chang C-H et al. BPC-157 effects on tendon outgrowth in vitro — (2011) doi:10.1016/j.jss.2010.02.010 --- # Peptide: Cagrilintide URL: https://peptide-research.org/directory/cagrilintide Category: Metabolic Status: Investigational Last reviewed: 2026-05-10 Aliases: AM833, Long-acting amylin analog Summary: An investigational long-acting amylin analog studied for appetite regulation, satiety, obesity, and combination use with semaglutide in CagriSema. ## Overview Cagrilintide is a long-acting analog of amylin, a pancreatic hormone involved in satiety and post-meal glucose regulation. It is best known publicly as the amylin component of CagriSema. ## The Science Amylin signaling complements incretin signaling but is not the same pathway. - **Satiety signaling** - amylin contributes to meal termination and fullness. - **Gastric and glucose context** - amylin biology intersects with postprandial regulation. - **Combination research** - cagrilintide is studied with semaglutide to layer amylin and GLP-1 effects. ## Evidence Snapshot Cagrilintide is investigational. The strongest public evidence is in controlled clinical trials, especially in combination with semaglutide, not arbitrary vendor blends. > **Research Lens** > > Cagrilintide is the amylin side of the CagriSema story. Understanding amylin makes the combination easier to interpret. ## Citations - Frias JP et al. Co-administered cagrilintide 2.4 mg with semaglutide 2.4 mg in type 2 diabetes — (2023) doi:10.1016/S0140-6736(23)01163-7 - Garvey WT et al. Coadministered cagrilintide and semaglutide in adults with overweight or obesity — (2025) doi:10.1056/NEJMoa2502081 --- # Peptide: CagriSema URL: https://peptide-research.org/directory/cagrisema Category: Blends Status: Investigational Last reviewed: 2026-05-10 Aliases: Cagrilintide + Semaglutide, CagriSema 5 mg + 5 mg, CagriSema 10 mg + 10 mg Summary: A fixed-dose investigational metabolic combination pairing the long-acting amylin analog cagrilintide with the GLP-1 receptor agonist semaglutide, studied for obesity and type 2 diabetes. ## Overview **It's completely reasonable - and intelligent - to be curious about CagriSema.** > **Educational Note** > > CagriSema is useful to study because it is not simply "more GLP-1." It combines GLP-1 receptor agonism with amylin-pathway signaling, giving researchers a window into how satiety, gastric emptying, glycemic control, and body-weight regulation can be layered. CagriSema is the development name for co-administered or fixed-dose **cagrilintide plus semaglutide**. Semaglutide is already covered in this library as a long-acting GLP-1 receptor agonist. Cagrilintide is a long-acting analog of amylin, a pancreatic hormone involved in meal-related satiety and postprandial glucose control. Commercial or research-vendor labels such as "5 mg + 5 mg" and "10 mg + 10 mg" are best understood as product-format labels unless a source specifies an actual protocol. The major clinical trials use carefully escalated once-weekly regimens and should not be treated as interchangeable with vial-size shorthand. ## The Science: GLP-1 Plus Amylin The combination logic is straightforward: semaglutide and cagrilintide both influence food intake, but they do it through partly distinct hormone systems. - **Semaglutide** activates GLP-1 receptors, improving glucose-dependent insulin secretion, reducing glucagon, slowing gastric emptying, and acting on appetite pathways. See the [Semaglutide profile](/directory/semaglutide) for full background. - **Cagrilintide** is an amylin analog designed for longer duration than native amylin. Amylin signaling contributes to satiety, meal termination, and glucose handling. The clinical hypothesis is that the two signals can produce greater weight loss and metabolic effect than either component alone, while sharing a tolerability profile dominated by gastrointestinal effects. ## What Researchers Have Observed - **Phase 2 type 2 diabetes research.** Co-administered cagrilintide 2.4 mg plus semaglutide 2.4 mg improved weight and glycemic outcomes compared with single-agent comparators in a small randomized trial. - **REDEFINE obesity research.** Phase 3 results reported substantially greater body-weight reduction with CagriSema than placebo, with comparisons against semaglutide and cagrilintide alone in adults without diabetes. - **Type 2 diabetes and obesity research.** REDEFINE 2 studied adults with type 2 diabetes and overweight or obesity, where the combination improved weight and glycemic markers compared with placebo. - **Tolerability research.** Gastrointestinal adverse events and dose escalation remain central to interpreting the program, as with the broader incretin drug class. ## The Empowerment Angle: Understanding Combination Metabolic Pharmacology Many people researching CagriSema are trying to understand the next generation of metabolic medicines: - **Why one appetite hormone is not the whole story** - GLP-1, amylin, GIP, glucagon, and other signals each contribute different biology. - **How trial endpoints should be read** - body-weight change, glycemic control, discontinuation rates, and adverse events all matter. - **Why vendor labels can be misleading** - milligram-per-vial language is not the same thing as a studied dose-escalation regimen. - **How combination drugs differ from casual stacking** - CagriSema is being tested as a controlled pharmaceutical combination, not merely two products used together. That distinction is the whole learning opportunity: combination pharmacology can be rigorous, but only when the formulation, escalation schedule, endpoints, and safety monitoring are defined. ## State of the Evidence **Important context**: CagriSema has human phase 2 and phase 3 trial data, but regulatory status and labeling should be checked against current authorities before drawing any practical conclusion. - The strongest evidence is for the defined cagrilintide 2.4 mg plus semaglutide 2.4 mg development program. - It should not be treated as equivalent to arbitrary "cagrilintide + semaglutide" blends from nonstandard sources. - The safety and tolerability picture is dominated by class-expected gastrointestinal effects, plus the uncertainty that comes with any investigational combination. - As with all metabolic injectables, product identity, purity, dose escalation, and clinical supervision materially change risk. ## Approaching Research Responsibly If you're researching CagriSema, the most grounded approach is to treat it as a clinical-trial literacy topic first: > **Practical Framework** > > 1. **Learn both pathways first** - GLP-1 and amylin are complementary but distinct. > 2. **Separate vial labels from trial regimens** - "5 mg + 5 mg" and "10 mg + 10 mg" labels do not define safe or studied use. > 3. **Read efficacy and tolerability together** - body-weight change without discontinuation and adverse-event context is incomplete. > 4. **Track regulatory status directly** - investigational combinations can change status, labeling, or development direction. > 5. **Use component-level literacy** - understand semaglutide separately before interpreting combination claims. The mature approach is not hype or dismissal, but careful reading of a serious metabolic-drug development program. *This entry is designed to help you understand both the science and the human motivation behind researching CagriSema. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Frias JP et al. Co-administered cagrilintide 2.4 mg with semaglutide 2.4 mg in type 2 diabetes — (2023) doi:10.1016/S0140-6736(23)01163-7 - Garvey WT et al. Coadministered cagrilintide and semaglutide in adults with overweight or obesity — (2025) doi:10.1056/NEJMoa2502081 - Davies MJ et al. Cagrilintide-semaglutide in adults with overweight or obesity and type 2 diabetes — (2025) doi:10.1056/NEJMoa2502082 --- # Peptide: Cardiogen URL: https://peptide-research.org/directory/cardiogen Category: Longevity Status: Research compound Last reviewed: 2026-05-10 Aliases: Ala-Glu-Asp-Arg, AEDR Sequence: AEDR Summary: A short bioregulator peptide discussed in cardiovascular-aging research traditions, usually represented by the tetrapeptide Ala-Glu-Asp-Arg. ## Overview Cardiogen is a short bioregulator peptide generally represented as Ala-Glu-Asp-Arg. It is discussed in cardiovascular and aging-focused peptide literature. ## The Science The proposed research frame is tissue-specific signaling rather than classic receptor pharmacology. - **Cardiac cell models** - cellular stress, repair, and aging hypotheses. - **Vascular biology** - cardiovascular tissue resilience claims. - **Bioregulator category** - evidence often comes from regional literature and preclinical systems. ## Evidence Snapshot Cardiogen should be treated as a research peptide with limited high-quality human evidence. The scientific question is whether short bioregulator peptides have reproducible tissue-specific effects. > **Research Lens** > > For Cardiogen, distinguish mechanistic or regional literature from clinical outcome evidence. --- # Peptide: Cartalax URL: https://peptide-research.org/directory/cartalax Category: Healing & Recovery Status: Research compound Last reviewed: 2026-05-10 Aliases: Cartilage bioregulator peptide Summary: A bioregulator peptide product discussed in cartilage, joint, and connective-tissue aging contexts, with evidence best treated as preliminary and formulation-dependent. ## Overview Cartalax is a peptide-adjacent bioregulator product marketed around cartilage and joint tissue. Unlike single-sequence peptides, product identity and composition may vary by source. ## The Science The research premise is support of cartilage-cell function and extracellular-matrix maintenance. - **Cartilage matrix biology** - collagen, proteoglycans, and chondrocyte function. - **Joint aging** - tissue maintenance and inflammatory wear patterns. - **Bioregulator uncertainty** - product definitions need to be checked carefully. ## Evidence Snapshot Cartalax does not have the evidence depth of established osteoarthritis medicines or well-characterized single peptides. It belongs in the directory as a research profile, not a validated joint therapy. > **Research Lens** > > When a product is sold as a tissue bioregulator, first confirm whether it is a defined sequence, an extract, or a branded mixture. --- # Peptide: Cerebrolysin URL: https://peptide-research.org/directory/cerebrolysin Category: Cognitive Status: Investigational Last reviewed: 2026-04-17 Aliases: FPE 1070, peptidergic nootropic Summary: A parenteral preparation of small peptides and amino acids derived from porcine brain protein, used clinically for decades across stroke, dementia, and traumatic brain injury recovery in many countries outside the US. ## Overview **It's completely reasonable — and intelligent — to be curious about Cerebrolysin.** > **Educational Note** > > Wanting to protect your brain, recover faster from cognitive setbacks, or simply understand what supports long-term neurological health is one of the most important forms of curiosity there is. Cerebrolysin has a long clinical history in this space — studying it means learning how the brain actually heals and maintains itself. Cerebrolysin is a preparation of enzymatically processed porcine brain proteins, yielding a defined mixture of low-molecular-weight peptides (under ~10 kDa) and free amino acids. It is manufactured by Ever Neuro Pharma and is registered in many countries — Austria, Germany, Russia, China, and most Asian and Latin American markets — though not by the FDA. Clinical use spans several decades across neurological indications. The appeal is straightforward: many people researching Cerebrolysin are thinking about brain health long-term — recovery from concussion or stroke, cognitive resilience, or supporting a loved one through neurodegeneration. They want to understand what a neurotrophic-mimicking preparation can and can't do. ## The Science: Broad Neurotrophic Mimicry Think of Cerebrolysin as a *peptide cocktail* rather than a single drug. Because it's a complex mixture, its mechanism is described at a systems level rather than at a single receptor: - **Neurotrophic mimicry** — effects broadly analogous to BDNF and GDNF on neuronal survival and differentiation - **Reduced excitotoxicity** in ischemic and injured brain tissue - **Amyloid processing modulation** in preclinical Alzheimer's models - **Antioxidant and anti-inflammatory activity** at sites of CNS injury The idea is that the body's own repair signals for neurons are themselves short peptides and amino acids — Cerebrolysin provides a mixture intended to echo those endogenous cues. ## What Researchers Have Observed - **Acute ischemic stroke recovery.** The CARS program (CARS-1, CARS-2) reported modest functional improvement when added to standard stroke care in early post-stroke recovery. - **Vascular dementia.** Multiple trials over the decades have reported cognitive improvements versus placebo on standard dementia rating scales, with varying methodological strength. - **Alzheimer's disease.** Studies in mild-to-moderate AD have shown modest symptomatic benefit, particularly on global clinical impression and ADAS-cog measures. - **Traumatic brain injury recovery.** Research programs in moderate-to-severe TBI have reported improvements in Glasgow Outcome Scale scores and reduced long-term disability in certain subgroups. - **Pediatric neurological research.** Studies in developmental and post-injury pediatric contexts exist, primarily in countries where Cerebrolysin is registered for clinical use. ## The Empowerment Angle: Quality of Life Research Many people researching Cerebrolysin aren't looking for a miracle nootropic. They're exploring it as part of: - **Understanding how the brain repairs itself** — what neurotrophic signaling actually does - **Supporting recovery after concussion, stroke, or cognitive decline** — in themselves or a loved one - **Taking brain healthspan seriously** alongside sleep, exercise, and cognitive engagement - **Working with a knowledgeable clinician** where Cerebrolysin is legally available and prescribed - **Contributing to citizen-science documentation** of subjective and objective cognitive changes The philosophy here is informed engagement — understanding that a mixture of brain-derived peptides is a different kind of intervention than a single targeted molecule. ## State of the Evidence **Important context**: The Cochrane Review (2020) concluded that evidence in acute ischemic stroke is insufficient to determine effect on death or dependency, citing methodological heterogeneity. Later independent trials (CARS-1, ESCAS) reported more consistent results but effect sizes remain modest. - Because it is a biological preparation from animal source material, batch consistency, immunogenicity, and pharmaceutical-grade purity are considerations that differ from those of a synthetic single-peptide product - The clinical literature is large but methodologically varied - Not FDA-approved; regulatory status varies widely by country This doesn't mean the research is uninteresting — decades of clinical use across many countries provide a substantial real-world record. The honest framing is that Cerebrolysin's effect sizes are modest and best understood as one component of a broader neurological-care approach. ## Approaching Research Responsibly If you're considering researching this compound, the most empowered approach combines curiosity with rigor: > **Practical Framework** > > 1. **Learn the biology first** — Understanding neurotrophic signaling, excitotoxicity, and why a peptide mixture might differ from a single drug gives you context for interpreting outcomes > 2. **Set clear, measurable outcomes** — cognitive testing, recovery milestones, symptom diaries, or specific functional measures > 3. **Start conservatively, with clinical oversight where possible** — Cerebrolysin is clinically used in many countries and working with a prescribing clinician is often the most sensible path > 4. **Build on strong foundations** — sleep, cardiovascular fitness, cognitive engagement, and nutrition remain the primary drivers of brain healthspan > 5. **View it as educational research** — the goal is insight into your own neurological resilience, not a shortcut around foundational habits The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry was rewritten to help you understand both the science and the human motivation behind researching Cerebrolysin. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Bornstein NM et al. Safety and efficacy of Cerebrolysin in early post-stroke recovery (CARS-1) — (2018) doi:10.1111/ane.12863 - Álvarez XA et al. Cerebrolysin: clinical development to date — (2011) doi:10.2174/156720511796256066 - Ziganshina LE et al. Cerebrolysin for acute ischaemic stroke (Cochrane Review) — (2020) doi:10.1002/14651858.CD007026.pub6 --- # Peptide: CJC-1295 URL: https://peptide-research.org/directory/cjc-1295 Category: Growth Hormone Status: Research compound Last reviewed: 2026-04-17 Aliases: Modified GRF (1-29), with DAC: CJC-1295 DAC Summary: A synthetic analog of growth-hormone-releasing hormone (GHRH) engineered for extended half-life, studied for prolonged stimulation of pulsatile GH and IGF-1 release — a tool researchers and self-experimenters use to explore their own endocrine biology. ## Overview **It's completely reasonable — and intelligent — to be curious about CJC-1295.** > **Educational Note** > > Wanting to understand your own growth hormone axis — how it declines with age, how it shapes body composition, and how it responds to sleep and training — is one of the most useful forms of self-education. CJC-1295 is an especially interesting tool for that inquiry because it exists in two forms that teach different lessons about pulsatile vs sustained GH signaling. CJC-1295 is a synthetic analog of the N-terminal 1–29 region of GHRH, engineered to extend its action. Two versions appear in literature and commerce: one without a Drug Affinity Complex ("Mod GRF 1-29"), with a short half-life similar to native GHRH; and one with a DAC moiety that covalently binds serum albumin in vivo, extending the half-life to roughly one week. The appeal is straightforward: many people researching CJC-1295 aren't looking for a GH shortcut — they want to understand how endogenous GH release works, how it changes with age, and how to support body composition and recovery while preserving feedback control. ## The Science: Extending GHRH's Signal Think of CJC-1295 as a *stabilized GHRH signal*. Native GHRH is rapidly degraded by the enzyme DPP-4, giving it a half-life of minutes. CJC-1295's modifications — a D-alanine substitution at position 2 and, in the DAC version, a maleimidopropionic-acid group that forms an albumin conjugate — resist enzymatic cleavage and extend exposure dramatically. Downstream effects flow through the canonical pathway: - **GHRH-R activation** on pituitary somatotrope cells - **cAMP signaling** leading to GH synthesis and release - **Pulsatile GH secretion** (short-acting form) or more sustained elevation (DAC form) - **Hepatic IGF-1 production** as the longer-acting downstream signal The choice between forms is pharmacologically meaningful. The short-acting version preserves pulsatility — the natural rhythm GH evolved to work in. The DAC version produces more continuous signaling, which is a different biological condition. ## What Researchers Have Observed - **Sustained GH and IGF-1 elevation.** In healthy-adult clinical pharmacology, CJC-1295 with DAC produced sustained elevations in GH and IGF-1 lasting roughly a week per dose, while preserving some pulsatile rhythm in the underlying secretion. - **Body composition research.** Prolonged IGF-1 elevation is of research interest in contexts of muscle preservation and age-related somatopause, though long-term human outcome data specific to CJC-1295 are limited. - **Pituitary function probes.** The compound is used in research pharmacology as a tool to study GHRH-R biology and the somatotrope axis. - **GHRH + GHS combinations.** Research combining GHRH analogs like CJC-1295 with GHS agents (such as ipamorelin) is motivated by synergistic acute GH release observed in pharmacology studies. - **Historical clinical program.** ConjuChem advanced CJC-1295 through early-phase clinical studies in HIV-associated lipodystrophy before discontinuing the program; that trial data contributes the core human pharmacokinetic dataset. ## The Empowerment Angle: Quality of Life Research Many people researching CJC-1295 aren't looking for a magic anti-aging drug. They're exploring it as part of: - **Understanding their own endocrine system** — how GH, IGF-1, sleep, and training interrelate - **Exploring pulsatile vs sustained GH biology** as two distinct pharmacologic conditions - **Supporting body composition and recovery** while preserving physiologic feedback - **Taking an active role in healthspan** rather than passively accepting somatopause - **Contributing to citizen science** through careful documentation of body composition, sleep, and lab markers The philosophy is informed self-experimentation grounded in the actual biology of the GH axis. ## State of the Evidence **Important context**: Core pharmacology is well-characterized in healthy adults. - Long-term safety and efficacy data at grey-market dosing regimens have not been published - Both forms appear on the WADA Prohibited List — relevant for competitive athletes - Prolonged supraphysiologic IGF-1 elevation is a theoretical concern — sustained IGF-1 elevation has distinct biology from pulsatile GH/IGF-1 dynamics, which is the reason clinicians and researchers watch it in long-duration programs - Not FDA-approved This doesn't invalidate the research — it means CJC-1295 is best understood as a pharmacologic tool for studying the GH axis, with honest uncertainty about long-term outcomes at self-experimentation dosing. ## Approaching Research Responsibly If you're considering researching this compound, the most empowered approach combines curiosity with rigor: > **Practical Framework** > > 1. **Learn the biology first** — Understanding GHRH-R, DPP-4, pulsatile vs sustained signaling, and IGF-1 dynamics gives you context for what you're observing > 2. **Set clear, measurable outcomes** — body composition, sleep quality, training recovery, fasting glucose, and IGF-1 labs > 3. **Start conservatively with thorough documentation** — track timing, sleep, nutrition, training, and lab markers over meaningful time windows > 4. **Build on strong foundations** — sleep is the largest natural GH stimulus; resistance training, adequate protein, and caloric discipline remain primary drivers of body composition > 5. **View it as educational research** — the goal is insight into your own endocrine biology, not a shortcut around foundational habits The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry was rewritten to help you understand both the science and the human motivation behind researching CJC-1295. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Teichman SL et al. Prolonged stimulation of GH and IGF-1 secretion by CJC-1295, a long-acting analog of GHRH — (2006) doi:10.1210/jc.2005-1536 - Ionescu M, Frohman LA. Pulsatile secretion of GH stimulated by CJC-1295 in normal adults — (2006) doi:10.1210/jc.2006-1331 --- # Peptide: CJC-1295 (No DAC) + Ipamorelin URL: https://peptide-research.org/directory/cjc-1295-ipamorelin Category: Blends Status: Blend Last reviewed: 2026-04-17 Aliases: GHRH + GHS stack, Mod GRF (1-29) + Ipamorelin Summary: A compounded blend pairing a short-acting GHRH analog (CJC-1295 without DAC) with the selective GHS peptide Ipamorelin — popular in self-experimentation for its goal of mimicking physiologic, pulsatile growth hormone release rather than sustained elevation. ## Overview **It's completely reasonable — and intelligent — to be curious about CJC-1295 + Ipamorelin.** > **Educational Note** > > Wanting to understand your own growth hormone axis — how it changes with age, how it responds to sleep and training, and how it shapes body composition — is a deeply intelligent form of self-education. This blend is specifically designed to probe a classic pharmacology question: can you stimulate GH through two complementary pathways and preserve natural pulsatility? The CJC-1295 + Ipamorelin combination pairs a short-acting GHRH analog (CJC-1295 without the DAC moiety, typically called "Mod GRF 1-29") with a selective growth hormone secretagogue (Ipamorelin). Both act on the pituitary to induce *endogenous* GH release. Combined, they stimulate GH through two different upstream mechanisms, producing additive pharmacology in acute-dose studies. The appeal is straightforward: many people researching this blend aren't chasing a "GH shortcut" — they want to understand how their own pituitary responds, preserve the pulsatile rhythm that physiologic GH release relies on, and support body composition goals alongside training and sleep. ## The Science: Two Pathways, One Pituitary Think of the GH axis as having two complementary "green lights" on the pituitary: GHRH receptors and ghrelin/GHS receptors. Pressing both at once produces a larger release than either alone — the pharmacologic basis for the combination. - **CJC-1295 (No DAC), aka Mod GRF 1-29** — A 29-amino-acid GHRH analog with a D-alanine substitution at position 2 for DPP-4 resistance. Unlike the DAC version, it retains a short half-life (~30 minutes), producing a pulsatile GH release pattern rather than sustained elevation. See the [CJC-1295 profile](/directory/cjc-1295) for full background. - **Ipamorelin** — A selective ghrelin-receptor agonist that induces GH release without elevating cortisol, prolactin, or ACTH at typical research doses. See the [Ipamorelin profile](/directory/ipamorelin) for full background. Rationale for the combination: - **Synergistic pituitary output.** Published acute-dose studies describe additive or modestly synergistic GH release when GHRH and GHS agonists are co-administered. - **Preserved pulsatility.** Because neither component extends half-life dramatically (unlike the long-acting CJC-1295 DAC), the resulting GH release pattern resembles physiologic pulses rather than continuous elevation. - **Preserved feedback control.** Somatostatin feedback on the pituitary remains intact, which distinguishes this stack pharmacologically from exogenous recombinant GH. ## What Researchers Have Observed - **Body composition research.** Pulsatile GH stimulation is studied in contexts of muscle preservation, adipose reduction, and age-related GH decline, with the combination producing larger GH responses than single agents. - **GH axis physiology research.** The combination is used as a research tool to probe GHRH-R and GHSR-1a pharmacology. - **Post-menopausal and adult GH insufficiency research.** Academic interest in whether pulsatile stimulation provides a physiologic alternative to recombinant GH in select populations. - **Acute pharmacology.** Well-characterized in healthy adults at the component level; the blend itself has less formal combined-dose research. ## The Empowerment Angle: Quality of Life Research Many people researching this combination aren't looking for a "GH replacement." They're exploring it as part of: - **Understanding their own endocrine system** — how GH, IGF-1, sleep, and training interrelate - **Supporting body composition** while preserving the rhythmic, pulsatile GH biology that physiologic signaling depends on - **Curiosity about age-related GH decline** and whether stimulating endogenous release differs meaningfully from exogenous GH - **Taking an active role in healthspan** rather than passively watching somatopause unfold - **Contributing to citizen science** through careful documentation of training, sleep, body composition, and lab markers The philosophy is informed self-experimentation — understanding why pulsatile GH biology matters helps you interpret what you observe. ## State of the Evidence **Important context**: Component-level acute pharmacology is well-characterized in healthy-adult studies. - Long-term human outcome data specifically for the combination at sustained dosing are not published in peer-reviewed literature at the scale that would support efficacy claims for body composition or anti-aging endpoints - Both components appear on the WADA Prohibited List — relevant for competitive athletes - Neither component is FDA-approved - Most real-world use is in self-experimentation and compounding-pharmacy contexts This isn't an invalidation — it's an honest statement that component pharmacology is better studied than long-term combined-use outcomes. The stack remains a useful tool for learning about GH axis biology. ## Approaching Research Responsibly If you're considering researching this combination, the most empowered approach combines curiosity with rigor: > **Practical Framework** > > 1. **Learn the biology first** — Understanding GHRH-R, GHSR-1a, pulsatile vs sustained release, and the role of IGF-1 gives you context for what you're observing > 2. **Set clear, measurable outcomes** — body composition, sleep quality, training recovery, fasting glucose, IGF-1 levels > 3. **Start conservatively with thorough documentation** — track injection timing, sleep, training, nutrition, and subjective markers > 4. **Build on strong foundations** — sleep (the largest natural GH stimulus), resistance training, adequate protein, and caloric discipline remain primary drivers > 5. **View it as educational research** — the goal is insight into your own endocrine system, not a shortcut around foundational habits The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry was rewritten to help you understand both the science and the human motivation behind researching CJC-1295 + Ipamorelin. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Teichman SL et al. Prolonged stimulation of GH and IGF-1 secretion by CJC-1295, a long-acting analog of GHRH — (2006) doi:10.1210/jc.2005-1536 - Raun K et al. Ipamorelin, the first selective growth hormone secretagogue — (1998) doi:10.1530/eje.0.1390552 - Bowers CY. GH releasing peptides — structure and kinetics — (1998) doi:10.1016/S0169-328X(98)00217-6 --- # Peptide: Crystagen URL: https://peptide-research.org/directory/crystagen Category: Longevity Status: Research compound Last reviewed: 2026-05-10 Aliases: Immune bioregulator peptide Summary: A bioregulator peptide product discussed in immune and aging research contexts, with claims centered on immune resilience and cellular regulation rather than a single validated indication. ## Overview Crystagen is part of the bioregulator peptide category and is usually discussed around immune function and aging. It should not be confused with better-characterized single-molecule immunomodulators. ## The Science The hypothesis is that short peptide signals can affect cell regulation and tissue resilience. That broad framing makes evidence quality and product definition especially important. - **Immune regulation** - immune-cell function and stress-response themes. - **Aging biology** - gerontology and resilience claims. - **Formulation questions** - branded bioregulator products may not map cleanly to one sequence. ## Evidence Snapshot Crystagen has limited accessible, high-quality human evidence. It should be presented as a research and product-literacy topic, not as a proven immune intervention. > **Research Lens** > > For bioregulator products, the first evidence question is identity: what exact molecule or mixture is being studied? --- # Peptide: Dermorphin URL: https://peptide-research.org/directory/dermorphin Category: Cognitive Status: Research compound Last reviewed: 2026-05-10 Aliases: D-Ala2 dermorphin Summary: A potent opioid heptapeptide originally isolated from frog skin secretions and studied as a tool compound for mu-opioid receptor pharmacology and analgesia research. ## Overview Dermorphin is a naturally occurring opioid peptide notable for its unusual D-amino-acid residue and very high affinity for mu-opioid receptors. It is primarily a research tool for opioid pharmacology rather than a general wellness peptide. ## The Science Dermorphin's potency comes from how its structure fits the mu-opioid receptor. That makes it scientifically important, but it also places it in a risk category very different from cosmetic, metabolic, or repair-oriented peptides. - **Analgesia research** - used to probe opioid receptor signaling. - **Receptor selectivity** - studied as a model for mu-opioid activity. - **Peptide stereochemistry** - the D-amino-acid feature changes stability and receptor behavior. - **Doping and safety context** - illicit use has appeared in animal sport and anti-doping discussions. ## Evidence Snapshot Dermorphin should be treated as a potent neuroactive opioid peptide. Component-level pharmacology is not a basis for casual self-experimentation, and claims around it require a much higher safety bar than most entries in this library. > **Important Context** > > This is an opioid-receptor peptide. Research literacy here should focus on receptor pharmacology, safety, and legal controls rather than optimization claims. --- # Peptide: DSIP URL: https://peptide-research.org/directory/dsip Category: Cognitive Status: Research compound Last reviewed: 2026-04-17 Aliases: Delta Sleep-Inducing Peptide Sequence: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu Summary: A nine-amino-acid neuropeptide first isolated in 1977 from the cerebral venous blood of slow-wave-sleeping rabbits — a decades-long scientific puzzle studied for effects on sleep, stress tolerance, and neuroendocrine signaling. ## Overview **It's completely reasonable — and intelligent — to be curious about DSIP.** > **Educational Note** > > Sleep is the single highest-leverage variable in long-term health, cognition, and recovery. Wanting to understand the molecular signals your brain uses to shift into slow-wave sleep is deeply intelligent — and DSIP is one of the more fascinating, unresolved chapters in that story. DSIP (Delta Sleep-Inducing Peptide) is a nine-amino-acid neuropeptide first isolated in 1977 by Schoenenberger and Monnier from the cerebral venous blood of rabbits stimulated to produce slow-wave (delta) sleep. Despite the name, its role in sleep induction remains incompletely understood — research over decades has found diverse effects spanning sleep, stress response, and neuroendocrine signaling, without settling on a single canonical mechanism. The appeal is straightforward: many people researching DSIP aren't chasing a sedative. They're exploring whether a peptide implicated in slow-wave-sleep biology might support deeper rest, stress resilience, or recovery — and they want to understand an unusually puzzling piece of neurochemistry along the way. ## The Science: An Unresolved Signal Think of DSIP as a *scientific mystery* — a peptide with decades of observed effects but no tidy mechanism. Its biology remains an active research question: - **No identified DSIP-specific receptor.** Unlike most bioactive peptides, no dedicated DSIP receptor has been definitively characterized. - **Modulation of central neurotransmitters.** Reported effects on serotonin, dopamine, and GABA signaling, possibly via allosteric or indirect mechanisms. - **HPA-axis modulation.** Published work describes effects on ACTH and cortisol dynamics under stress conditions. - **Opioid system interaction.** Studies report reductions in opioid withdrawal severity in animal and small human studies. - **Possible carrier peptide behavior.** Some researchers propose DSIP acts as a metabolic or signaling carrier rather than a classical receptor ligand. This enigmatic profile is part of what makes DSIP interesting — 50 years of research on a short peptide that still hasn't given up its mechanism. ## What Researchers Have Observed - **Sleep research.** Small human studies have examined effects on slow-wave sleep, sleep latency, and sleep continuity, with variable results across populations and protocols. - **Chronic pain.** Russian clinical literature describes use in chronic pain syndromes, reporting reductions in pain intensity and opioid requirements. - **Opioid withdrawal.** Preclinical and small clinical studies examine DSIP as an adjunct during opioid withdrawal, with reports of reduced withdrawal severity. - **Stress tolerance.** Animal models of acute and chronic stress describe DSIP-induced improvements in behavioral measures of stress coping. - **Alcohol withdrawal.** Some Eastern European literature examines DSIP as an adjunct in alcohol withdrawal protocols. ## The Empowerment Angle: Quality of Life Research Many people researching DSIP aren't looking for a sedative substitute. They're exploring it as part of: - **Understanding their own sleep architecture** — slow-wave sleep, sleep latency, waking quality - **Supporting stress resilience** alongside training, nutrition, and recovery work - **Curiosity about unresolved neurochemistry** — DSIP is a fascinating case study in how peptide biology doesn't always fit tidy receptor models - **Taking an active role in sleep quality** rather than reaching for sedatives - **Contributing to citizen science** by carefully documenting sleep tracking data alongside subjective experience The philosophy is informed self-experimentation — and DSIP rewards that framing, because without a crisp mechanism, careful observation is the main way to learn anything meaningful. ## State of the Evidence **Important context**: DSIP has a long research history (~50 years) with a persistently enigmatic pharmacology — a peptide whose biology is well-documented but whose mechanism has resisted clean characterization. - Modern, well-powered clinical trials are sparse - Much of the human literature is from Eastern European research programs - It is not approved for any indication in Western jurisdictions, though it has been used clinically in some Eastern European countries - Variability in response across studies and protocols is the norm This doesn't invalidate the work — it accurately describes where the science sits. DSIP is an honest example of "more to learn" rather than "well-settled." ## Approaching Research Responsibly If you're considering researching this compound, the most empowered approach combines curiosity with rigor: > **Practical Framework** > > 1. **Learn the biology first** — Understanding slow-wave sleep, sleep architecture, the HPA axis, and why DSIP's mechanism remains unresolved gives you context for interpreting your own experience > 2. **Set clear, measurable outcomes** — sleep tracker data, subjective sleep quality, waking alertness, stress markers > 3. **Start conservatively with thorough documentation** — track sleep timing, caffeine, alcohol, training, and stressors alongside peptide use > 4. **Build on strong foundations** — sleep hygiene, consistent schedule, light exposure, caffeine timing, and exercise remain the primary drivers of sleep quality > 5. **View it as educational research** — the goal is insight into your own sleep and stress biology, not a shortcut around foundational habits The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry was rewritten to help you understand both the science and the human motivation behind researching DSIP. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Schoenenberger GA, Monnier M. Characterization of a delta-EEG-activity (“delta-sleep-inducing peptide”) — (1977) - Kovalzon VM, Strekalova TV. Delta sleep-inducing peptide (DSIP): a still unresolved riddle — (2006) doi:10.1002/jpep.5.1.31 - Graf MV, Kastin AJ. Delta-sleep-inducing peptide (DSIP): an update — (1986) doi:10.1016/0196-9781(86)90126-1 --- # Peptide: Epitalon URL: https://peptide-research.org/directory/epitalon Category: Longevity Status: Research compound Last reviewed: 2026-04-17 Aliases: Epithalon, Epitalamin fragment Sequence: Ala-Glu-Asp-Gly Summary: A synthetic tetrapeptide derived from the pineal preparation Epitalamin, studied for decades in Russian research for effects on telomerase activity, melatonin rhythm, and age-related biomarkers. ## Overview **It's completely reasonable — and intelligent — to be curious about Epitalon.** > **Educational Note** > > Wanting to understand aging biology, circadian rhythms, and whether short peptides can meaningfully influence age-related biomarkers is a deeply intelligent form of self-education. Epitalon is especially interesting because it sits at the crossroads of an unusual research tradition, striking claims, and real open questions about how short peptides signal. Epitalon is a synthetic tetrapeptide (Ala-Glu-Asp-Gly) developed by the Saint Petersburg Institute of Bioregulation and Gerontology, as a short synthetic analog of the Russian pineal-gland-sourced peptide preparation Epitalamin. Vladimir Khavinson's laboratory has been the primary source of its research over several decades, studying it in contexts related to aging biology, telomere dynamics, and circadian regulation. The appeal is straightforward: many people researching Epitalon aren't chasing an anti-aging miracle — they're curious about a small, elegant peptide whose research program has produced striking claims about telomerase and healthspan, and they want to engage with that evidence honestly. ## The Science: Short Peptides and Gene Expression Think of Epitalon as an entry in a broader theory — that very short peptides can act as *regulatory signals* influencing gene expression rather than as classical receptor ligands. Specific reported effects include: - **Telomerase activity.** Cell-culture studies from the Khavinson laboratory report activation of telomerase and extension of telomeres in human somatic cells — a central claim of the research program. - **Gene expression modulation.** Described effects on chromatin condensation and expression of genes associated with cellular aging. - **Pineal and melatonin regulation.** Reported influence on melatonin secretion and circadian rhythmicity, consistent with Epitalon's origin as an Epitalamin analog. - **Antioxidant pathways.** Some studies describe upregulation of antioxidant defenses and reductions in lipid peroxidation markers. The telomerase-activation claim is the most striking — and it's exactly the kind of claim that deserves careful independent replication before being taken as settled. ## What Researchers Have Observed - **Aging biomarker research.** Russian clinical studies have examined Epitalon's effects on age-associated biomarkers including melatonin rhythm, cortisol, and biological aging scores in older adults. - **Retinopathy.** Russian clinical use includes treatment of pigmentary retinopathy and age-related macular degeneration, with small published series reporting visual improvements. - **Longevity research.** Animal studies from the Khavinson group report extended median lifespan and reduced tumor incidence in rodent models. - **Immune and neuroendocrine rhythm research.** Small studies examine effects on thymic function and HPA-axis rhythms in aging. - **Basic science on short peptide signaling.** Epitalon is part of a broader research program on "short regulatory peptides" — very short sequences proposed to act through gene-expression modulation. ## The Empowerment Angle: Quality of Life Research Many people researching Epitalon aren't looking for immortality. They're exploring it as part of: - **Understanding aging biology** — telomeres, circadian rhythms, pineal function, and short-peptide signaling - **Supporting circadian health** — melatonin rhythm, sleep quality, and age-related rhythm changes - **Taking an active role in healthspan** rather than passively accepting biological aging - **Engaging with unfamiliar research traditions** critically rather than dismissively - **Contributing to citizen science** through careful documentation of sleep, biomarkers, and subjective wellbeing The philosophy is informed self-experimentation — engaging thoughtfully with claims that sit outside the Western clinical mainstream without either dismissing them or accepting them uncritically. ## State of the Evidence **Important context**: Epitalon's evidence base is concentrated heavily in a single Russian research group, with limited independent Western replication — a pattern that makes the findings harder to evaluate than peptides with multiple independent lines of evidence. - The telomerase-activation claim is striking but has not been independently confirmed at scale in mainstream aging biology literature - Much of the clinical work is published in Russian-language journals with varying methodological rigor - Epitalon is not approved for any indication outside Russia and some former-Soviet countries - The short-peptide-signaling theory itself remains a minority view in mainstream molecular biology This doesn't mean the research is wrong — it means the evidence is still early and concentrated. Epitalon is best approached as an interesting open question rather than a proven intervention. ## Approaching Research Responsibly If you're considering researching this compound, the most empowered approach combines curiosity with rigor: > **Practical Framework** > > 1. **Learn the biology first** — Understanding telomeres, the pineal gland, melatonin rhythm, and the broader debate about short-peptide signaling gives you context for interpreting claims > 2. **Set clear, measurable outcomes** — sleep quality, circadian markers, subjective wellbeing, and any available biomarker panels > 3. **Start conservatively with thorough documentation** — track sleep, light exposure, and rhythm-related variables alongside peptide use > 4. **Build on strong foundations** — sleep, circadian hygiene, nutrition, exercise, and stress management remain the primary drivers of healthspan > 5. **View it as educational research** — engage with the evidence critically, not as a believer or a skeptic The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry was rewritten to help you understand both the science and the human motivation behind researching Epitalon. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Khavinson VK et al. Peptide Epitalon activates chromatin at the old age — (2003) doi:10.1023/A:1024767324643 - Khavinson VK et al. Effect of Epitalon on biomarkers of aging in humans — (2003) - Anisimov VN et al. Effect of Epitalon on life span and tumor incidence in animal models — (2003) --- # Peptide: EPO URL: https://peptide-research.org/directory/epo Category: Healing & Recovery Status: FDA-approved Last reviewed: 2026-05-10 Aliases: Erythropoietin, Epoetin Compound class: Glycoprotein hormone Summary: A glycoprotein hormone that stimulates red blood cell production, used clinically for specific anemia indications and tightly controlled because of thrombotic and doping risks. ## Overview EPO is erythropoietin, a glycoprotein hormone that stimulates red blood cell production. It is a regulated medicine in specific anemia contexts and a major anti-doping concern in sport. ## The Science EPO acts on erythroid progenitor cells in bone marrow, increasing red blood cell production when clinically appropriate. - **Anemia medicine** - chronic kidney disease and selected treatment-related anemia contexts. - **Oxygen transport** - increased red cell mass changes oxygen-carrying capacity. - **Risk profile** - excessive erythropoiesis can increase blood viscosity and thrombotic risk. ## Evidence Snapshot EPO is clinically powerful and medically useful in the right context. It is not a wellness peptide, and use outside monitored indications carries serious risk. > **Important Context** > > EPO changes blood physiology. Hemoglobin, hematocrit, blood pressure, clotting risk, and indication all matter. --- # Peptide: FOXO4-DRI URL: https://peptide-research.org/directory/foxo4-dri Category: Longevity Status: Research compound Last reviewed: 2026-05-10 Aliases: FOXO4 D-retro-inverso peptide, FOXO4-DRI peptide Summary: A cell-penetrating D-retro-inverso peptide studied preclinically for disrupting FOXO4-p53 interactions in senescent-cell research models. ## Overview FOXO4-DRI is a D-retro-inverso peptide designed to interfere with interactions between FOXO4 and p53 in senescent-cell models. It is one of the more visible experimental peptide ideas in senolytic research. ## The Science The proposed mechanism is selective pressure on senescent cells by altering FOXO4-p53 signaling. That makes it interesting, but it also means the evidence bar is high. - **Senescence biology** - cells that persist in a stress-arrested state. - **FOXO4-p53 signaling** - proposed target interaction. - **Preclinical aging models** - much of the public interest comes from animal and cell data. ## Evidence Snapshot FOXO4-DRI is not an approved anti-aging therapy. It remains a preclinical research compound with major questions around selectivity, delivery, safety, and reproducibility. > **Important Context** > > Senolytic claims should be held to a high standard. Removing damaged cells is a serious biological intervention, not a generic wellness pathway. --- # Peptide: GDF-8 URL: https://peptide-research.org/directory/gdf-8 Category: Growth Hormone Status: Research compound Last reviewed: 2026-05-10 Aliases: Myostatin, Growth Differentiation Factor 8 Compound class: Protein cytokine Summary: A TGF-beta family protein better known as myostatin, the major negative regulator of skeletal muscle growth and a target in muscle-wasting research. ## Overview GDF-8 is myostatin, a TGF-beta family protein that acts as a major brake on skeletal muscle growth. It is not a typical peptide product; it is usually discussed as a target. ## The Science Blocking myostatin signaling can increase muscle mass in animal models and certain genetic contexts, but translating that safely into human therapy is difficult. - **Muscle growth regulation** - myostatin limits hypertrophy. - **Wasting disorders** - target for muscular dystrophy, cachexia, and sarcopenia research. - **Pathway breadth** - TGF-beta family signaling is biologically interconnected. ## Evidence Snapshot GDF-8 is more accurately a pathway target than a wellness product. Claims around "myostatin blockers" need careful evidence review. > **Research Lens** > > When you see GDF-8, ask whether the product is myostatin itself, an inhibitor, an antibody, a receptor trap, or a marketing label. --- # Peptide: GHK-Cu URL: https://peptide-research.org/directory/ghk-cu Category: Healing & Recovery Status: Research compound Last reviewed: 2026-04-17 Aliases: Copper Tripeptide-1, Cu-GHK Sequence: Gly-His-Lys (with bound Cu²⁺) Summary: A naturally occurring copper-binding tripeptide studied for skin regeneration, hair biology, and extracellular matrix remodeling, with one of the most mature cosmetic and wound-healing research literatures in the peptide space. ## Overview **It's completely reasonable — and intelligent — to be curious about GHK-Cu.** > **Educational Note** > > Wanting to understand how your skin ages, how your hair follicles signal, and how wounds actually heal is a deeply intelligent form of curiosity. GHK-Cu is especially interesting because it's a naturally occurring human peptide with one of the longest and most mature research trails in the dermatology space. GHK-Cu is a naturally occurring copper-binding tripeptide (Gly-His-Lys with a Cu²⁺ ion) first identified in human plasma in 1973 by Loren Pickart. It is among the most-studied peptides in cosmetic and dermatologic science, with a research literature spanning more than 50 years across wound healing, skin regeneration, hair follicle biology, and gene expression. The appeal is straightforward: many people researching GHK-Cu aren't chasing a miracle skin product. They want to understand how the body's own repair signals work — and whether a peptide this thoroughly studied can meaningfully support skin quality, hair, and wound healing. ## The Science: A Copper Shuttle With Broad Biology Think of GHK-Cu as a *copper delivery vehicle* with an unusually broad secondary profile. Its signature feature is high-affinity copper binding — but the downstream effects reach further than a simple mineral cofactor story would suggest. - **Copper delivery.** GHK-Cu shuttles Cu²⁺ into cells, where copper serves as a cofactor for lysyl oxidase (collagen/elastin crosslinking) and superoxide dismutase (antioxidant defense). - **Gene expression modulation.** Genome-wide studies report that GHK-Cu influences expression of thousands of genes — generally shifting pro-inflammatory and senescence-associated programs toward regenerative profiles. - **ECM remodeling.** Stimulates fibroblast production of collagen, elastin, glycosaminoglycans, and proteoglycans. - **Anti-inflammatory effects.** Reduces pro-inflammatory cytokine expression in skin and wound contexts. - **Angiogenesis.** Promotes new blood vessel formation, relevant to wound healing and skin graft contexts. The unusual breadth of downstream effects is what makes GHK-Cu a recurring subject in aging and regeneration research. ## What Researchers Have Observed - **Skin aging and appearance.** Topical GHK-Cu is an established cosmetic ingredient with clinical data supporting reductions in fine lines, improved firmness, and better skin barrier function. - **Wound healing.** Preclinical and small clinical studies in diabetic ulcers, burns, and surgical wounds report improved healing time and tissue quality. - **Hair follicle biology.** GHK-Cu influences dermal papilla cell behavior and hair follicle stem cell activity; it is a common ingredient in topical hair-restoration formulations. - **Anti-inflammatory dermatology.** Research contexts include atopic dermatitis, rosacea, and post-procedure recovery. - **Systemic regenerative research.** Animal studies describe effects in lung, liver, and neurological repair, though topical/dermatologic use remains the best-evidenced application. ## The Empowerment Angle: Quality of Life Research Many people researching GHK-Cu aren't looking for a miracle cream. They're exploring it as part of: - **Understanding skin biology** — collagen, elastin, barrier function, and how skin ages - **Supporting hair follicle health** alongside broader scalp care and nutrition - **Supporting wound and post-procedure healing** methodically - **Taking an active role in their appearance and healthspan** rather than relying on marketed promises alone - **Contributing to citizen science** through careful before/after documentation and photography The philosophy is informed self-experimentation — understanding the biology lets you tell the difference between marketing and mechanism. ## State of the Evidence **Important context**: GHK-Cu has one of the more mature evidence bases among research peptides, with cosmetic dermatology as the strongest supported domain. - It is a common ingredient in FDA-registered cosmetic formulations (as Copper Tripeptide-1) - Extensively studied in vitro and in animal wound models - Topical efficacy for skin quality and wound healing is well supported - Systemic (injected) use has a thinner peer-reviewed base than topical use - Broader claims about systemic anti-aging effects are more speculative than the topical evidence This is a honest picture — GHK-Cu is one of the better-evidenced peptides for its topical applications, while systemic use remains an area of more exploratory research. ## Approaching Research Responsibly If you're considering researching this compound, the most empowered approach combines curiosity with rigor: > **Practical Framework** > > 1. **Learn the biology first** — Understanding copper biology, collagen/elastin synthesis, and skin barrier function gives you context for interpreting outcomes > 2. **Set clear, measurable outcomes** — photographic documentation, barrier metrics, specific wound or hair measurements over consistent time windows > 3. **Start conservatively with thorough documentation** — standardized lighting for photos, consistent routines, and clear timelines > 4. **Build on strong foundations** — sun protection, sleep, nutrition, and consistent skincare remain the primary drivers of skin quality > 5. **View it as educational research** — the goal is insight into your own skin and tissue biology, not a shortcut around foundational care The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry was rewritten to help you understand both the science and the human motivation behind researching GHK-Cu. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Pickart L, Margolina A. Regenerative and protective actions of the GHK-Cu peptide in the light of the new gene data — (2018) doi:10.3390/ijms19071987 - Pickart L et al. GHK, the human tripeptide with multiple physiological properties — (2015) doi:10.1155/2015/648108 - Choi HR et al. Anti-aging effects of a GHK-Cu peptide in human skin fibroblasts — (2012) doi:10.1016/j.jdermsci.2012.08.006 --- # Peptide: GHRP-6 URL: https://peptide-research.org/directory/ghrp-6 Category: Growth Hormone Status: Research compound Last reviewed: 2026-05-10 Aliases: GHRP-6 Acetate, Growth Hormone Releasing Peptide-6 Summary: A growth hormone secretagogue peptide that activates ghrelin/GHS receptors and is studied for GH release, appetite signaling, and endocrine-axis pharmacology. ## Overview GHRP-6 is one of the older growth hormone releasing peptides. It activates the growth hormone secretagogue receptor, the same broad receptor family involved in ghrelin signaling. ## The Science GHRP-6 is useful historically because it shows how GH release can be stimulated outside the GHRH receptor pathway. - **GH release** - stimulates pituitary growth hormone secretion. - **Appetite signaling** - ghrelin-receptor activity can increase hunger. - **Endocrine selectivity** - older GHRPs may have more off-target endocrine effects than newer agents such as ipamorelin. ## Evidence Snapshot GHRP-6 is a research secretagogue, not an approved anti-aging product. Interpretation should include GH pulses, IGF-1, glucose handling, appetite, and competitive-sport rules. > **Research Lens** > > GHRP-6 is best understood as an older ghrelin-receptor tool compound in the GH-axis family. --- # Peptide: GLO URL: https://peptide-research.org/directory/glo Category: Blends Status: Blend Last reviewed: 2026-04-17 Aliases: Compounded skin & gut blend Summary: A compounded peptide blend typically combining GHK-Cu, larazotide acetate, and additional peptides — formulated around the intersection of skin quality, hair support, and gut-barrier integrity, and studied by self-experimenters interested in that multi-tissue angle. ## Overview **It's completely reasonable — and intelligent — to be curious about GLO.** > **Educational Note** > > Wanting to understand the connections between gut-barrier integrity, skin quality, and overall inflammation is a genuinely intelligent form of self-education. These tissues share biology in ways that aren't always obvious — and GLO is one attempt to intervene at more than one of those layers at once. "GLO" is an acronym applied to compounded peptide blends focused on skin, hair, and gut support. Specific composition varies between compounding pharmacies — common core constituents are GHK-Cu and larazotide acetate, with additional peptides (orexin-adjacent, cosmetic, or recovery) appearing in some formulations. The appeal is straightforward: many people researching GLO aren't chasing a miracle combo. They're thinking about the gut-skin axis, barrier biology, and whether addressing multiple tissues at once is a more useful frame than treating each in isolation. ## The Science: A Multi-Component Formulation Think of GLO as a *toolkit* rather than a single drug — each component has its own research history, and the blend's logic depends on how you view their individual contributions. - **GHK-Cu** — A copper-binding tripeptide with decades of cosmetic and wound-healing literature. The most-evidenced component of the blend, with well-documented effects on fibroblasts, ECM remodeling, and gene expression relevant to skin and tissue repair. - **Larazotide acetate** — An 8-amino-acid peptide studied in celiac disease as a zonulin antagonist that modulates intestinal tight junctions. It reached Phase 2b in celiac-symptom control. - **Additional peptides** — Formulation-dependent. Some suppliers include orexin-like neuropeptides, additional skin peptides, or recovery peptides. The blend's rationale is layered: GHK-Cu targets skin and repair biology, larazotide acts on gut-barrier integrity, and optional additions extend the scope further. The combined pharmacology, however, has not been studied as a unit. ## What Researchers Have Observed (by component) - **Skin quality and barrier function.** GHK-Cu has a substantial dermatology and cosmetic literature on wrinkle reduction, barrier integrity, and wound healing — much of it at the level of topical cosmetic products. - **Hair follicle support.** Preclinical research on GHK-Cu describes effects on hair follicle stem cells and hair cycle modulation; it is a common constituent of topical hair-restoration formulations. - **Gut-barrier integrity.** Larazotide acetate modulates zonulin-mediated tight-junction opening; research contexts include celiac disease, leaky-gut hypotheses, and inflammatory bowel conditions. - **Anti-inflammatory support.** Both GHK-Cu and larazotide have anti-inflammatory effects in their respective tissue contexts (skin, gut mucosa). - **Wound healing.** GHK-Cu's role in extracellular matrix remodeling and angiogenesis has been explored in diabetic and pressure ulcer models. ## The Empowerment Angle: Quality of Life Research Many people researching GLO aren't looking for a cure. They're exploring it as part of: - **Understanding the gut-skin axis** — how barrier integrity, inflammation, and skin quality interact - **Exploring multi-tissue approaches** rather than isolating one symptom at a time - **Supporting recovery and appearance** alongside diet, sleep, and skincare fundamentals - **Taking an active role in their health** rather than reactively treating each symptom - **Contributing to citizen science** through careful documentation of skin, gut, and general wellbeing markers The philosophy is informed self-experimentation — especially important with blends, where you have to think carefully about which component is doing what. ## State of the Evidence **Important context**: As with other blends, there is no peer-reviewed pharmacology on GLO as a unit — only on its individual components, each studied separately. - GHK-Cu has the most mature evidence base, with decades of cosmetic and wound-healing work - Larazotide acetate is the most clinically advanced component overall, with Phase 2b data in celiac disease - Because formulations are not standardized, claims attributed to a GLO product reflect extrapolation from single-component research rather than trials of the blend itself - Formulation variability across compounding pharmacies is a real consideration This isn't a dismissal — it's an honest framing. GLO is best approached as a combination of individually-studied peptides, with the user actively interpreting which component contributes to which observation. ## Approaching Research Responsibly If you're considering researching this compound, the most empowered approach combines curiosity with rigor: > **Practical Framework** > > 1. **Learn the biology first** — Understanding GHK-Cu's mechanism, zonulin and tight-junction biology, and the gut-skin axis gives you context for interpreting outcomes > 2. **Set clear, measurable outcomes** — photographic documentation for skin, gut symptom diaries, hair metrics, and any relevant lab markers > 3. **Start conservatively with thorough documentation** — know which pharmacy, which formulation, which batch, and which components are included > 4. **Build on strong foundations** — diet, sleep, stress management, and consistent skincare remain the primary drivers for skin, hair, and gut health > 5. **View it as educational research** — with blends especially, the goal is understanding *which component* is driving what you observe The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry was rewritten to help you understand both the science and the human motivation behind researching GLO. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Pickart L, Margolina A. Regenerative and protective actions of the GHK-Cu peptide — (2018) doi:10.3390/ijms19071987 - Leffler DA et al. Larazotide acetate for persistent symptoms of celiac disease (CeD-PRO) — (2015) doi:10.1053/j.gastro.2015.02.008 --- # Peptide: GLOW Blend URL: https://peptide-research.org/directory/glow-blend Category: Blends Status: Blend Last reviewed: 2026-05-10 Aliases: GLOW, BPC-157 + GHK-Cu + TB-500, Glow peptide blend Summary: A compounded recovery and skin-focused peptide blend combining BPC-157, GHK-Cu, and TB-500; its rationale comes from component-level tissue-repair, copper-peptide, and cell-migration research. ## Overview **It's completely reasonable - and intelligent - to be curious about GLOW.** > **Educational Note** > > GLOW is best understood as a compounded stack hypothesis: combine a copper peptide, a gastric repair peptide, and a thymosin beta-4 fragment, then aim the blend at skin quality and tissue recovery. The important question is how much of that story comes from component evidence versus blend evidence. GLOW commonly refers to compounded blends containing **BPC-157, GHK-Cu, and TB-500**. This page covers that formulation specifically. It is distinct from the existing [GLO profile](/directory/glo), which describes a different formulation centered on GHK-Cu, larazotide acetate, and gut-skin barrier logic. Like other vendor blends, GLOW is not a standardized pharmaceutical product. Ratios, concentrations, route, and quality controls vary across suppliers. ## The Science: Three Repair-Oriented Components The blend's logic comes from three component literatures: - **BPC-157** - A gastric pentadecapeptide with extensive preclinical work in tissue protection, tendon and ligament injury models, angiogenesis, and gut repair. See the [BPC-157 profile](/directory/bpc-157) for full background. - **GHK-Cu** - A copper-binding tripeptide with dermatology and cosmetic research around extracellular matrix remodeling, collagen, skin quality, hair biology, and wound repair. See the [GHK-Cu profile](/directory/ghk-cu) for full background. - **TB-500** - A thymosin beta-4 fragment associated with actin dynamics, cell migration, angiogenesis, and tissue-repair models. See the [TB-500 profile](/directory/tb-500) for full background. The stack hypothesis is that tissue repair and skin quality depend on multiple processes at once: inflammation resolution, vascular support, cell migration, and matrix remodeling. ## What Researchers Have Observed - **Skin and wound biology.** GHK-Cu has the strongest skin-facing evidence base among the components, including cosmetic and wound-healing literature. - **Soft-tissue repair.** BPC-157 and thymosin beta-4-derived peptides are discussed mostly through preclinical tendon, ligament, muscle, and wound models. - **Angiogenesis and migration.** BPC-157 and TB-500 are both commonly invoked for vascular and cell-migration effects, though much of the evidence is animal or cell-level. - **The blend itself.** There is no peer-reviewed pharmacology establishing GLOW as a defined combination product. ## The Empowerment Angle: Reading Blend Claims Carefully People researching GLOW are usually interested in visible and functional recovery: - **Skin quality, hair, and cosmetic repair** - **Joint, tendon, or soft-tissue recovery** - **How copper peptide biology differs from classic repair-peptide claims** - **Whether multi-component blends add insight or just attribution problems** - **How to document outcomes when several mechanisms are being tested at once** The biggest practical challenge is interpretation. If skin texture, wound healing, soreness, or recovery changes, the blend makes it harder to know which component, if any, contributed. ## State of the Evidence **Important context**: GLOW has component-level evidence, not blend-level clinical validation. - GHK-Cu has the most developed skin and cosmetic literature. - BPC-157 and TB-500 are mostly supported by preclinical and mechanistic studies. - Component ratios vary across sellers. - No peer-reviewed trials define GLOW's safety, efficacy, or optimal formulation as a unit. - Quality control matters more with blends because identity and concentration must be correct for multiple ingredients, not just one. ## Approaching Research Responsibly If you're researching GLOW, the most grounded approach is to decompose the blend before interpreting it: > **Practical Framework** > > 1. **Learn each component separately** - GHK-Cu, BPC-157, and TB-500 have different evidence profiles. > 2. **Define the exact formulation** - component list, ratios, concentration, route, and supplier all matter. > 3. **Use measurable outcomes** - photos, wound dimensions, range of motion, training logs, and symptom scales are better than vague impressions. > 4. **Expect attribution problems** - a blend makes cause-and-effect harder to interpret. > 5. **Build on fundamentals** - sleep, protein, rehab loading, skin care, and injury management remain primary. The mature framing is that GLOW is a multi-component research hypothesis, not a proven recovery or cosmetic product. *This entry is designed to help you understand both the science and the human motivation behind researching GLOW. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Pickart L, Margolina A. Regenerative and protective actions of the GHK-Cu peptide — (2018) doi:10.3390/ijms19071987 - Sikiric P et al. Stable gastric pentadecapeptide BPC 157 and wound healing — (2018) doi:10.2174/1381612825666181129110005 - Goldstein AL et al. Thymosin beta-4: repair biology review — (2005) doi:10.1038/nrm1587 --- # Peptide: Glutathione URL: https://peptide-research.org/directory/glutathione Category: Longevity Status: Investigational Last reviewed: 2026-04-17 Aliases: GSH, γ-Glu-Cys-Gly Sequence: γ-Glu-Cys-Gly Summary: An endogenous tripeptide and the body's most abundant intracellular antioxidant, used clinically as an IV adjunct in hepatic, dermatologic, and neurological contexts and studied for oxidative stress and detoxification biology. ## Overview **It's completely reasonable — and intelligent — to be curious about Glutathione.** > **Educational Note** > > Wanting to understand your own antioxidant biology, detoxification pathways, and how cells handle oxidative stress is one of the most useful forms of self-education in health. Glutathione sits at the center of that biochemistry — and learning about it teaches you a lot about how the body actually maintains cellular health. Glutathione is an endogenous tripeptide (γ-Glu-Cys-Gly) and the most abundant intracellular antioxidant in human cells — present at millimolar concentrations in the cytoplasm. It is a peptide in the strict biochemical sense, though the γ-linkage at the N-terminus distinguishes it from standard α-peptide bonds. Glutathione is used clinically and investigationally across antioxidant, hepatic, dermatologic, and neurodegenerative contexts, and is widely offered in IV therapy clinics. The appeal is straightforward: many people researching glutathione aren't chasing a "super antioxidant." They're asking practical questions — does my body make enough, how does oxidative stress affect me, and what routes of supplementation actually change cellular glutathione status? ## The Science: The Cell's Master Antioxidant Think of glutathione as the cell's *primary redox buffer* — the molecule your cells use, constantly, to neutralize reactive species and maintain a functional chemical environment. - **Primary cellular antioxidant.** Reduces reactive oxygen species and peroxides directly, and serves as the cofactor for glutathione peroxidase. - **Redox homeostasis.** The GSH/GSSG (reduced/oxidized) ratio is a core cellular redox buffer; glutathione depletion is a sensitive marker of oxidative stress. - **Phase II detoxification.** Conjugates xenobiotics and reactive metabolites in the liver via glutathione S-transferase enzymes, a central pathway in drug and toxin clearance. - **Protein thiol regulation.** Via glutathionylation, regulates the redox state of cysteine residues on enzymes and receptors, influencing signal transduction. - **Mitochondrial protection.** Mitochondrial glutathione pools are critical for electron transport chain stability. Unlike most peptides, glutathione isn't obscure — it's one of the most thoroughly studied molecules in biochemistry. ## What Researchers Have Observed - **Hepatic disease.** IV and oral glutathione have been studied in non-alcoholic fatty liver disease, with reports of reductions in hepatic enzyme levels. N-acetylcysteine (NAC), a glutathione precursor, is the standard of care for acetaminophen toxicity. - **Skin hyperpigmentation.** Oral and IV glutathione are marketed (particularly in parts of Asia) as skin-lightening agents; peer-reviewed clinical evidence is modest but consistent, and the mechanism is established (inhibition of melanogenesis via tyrosinase modulation). - **Parkinson's disease.** Intranasal glutathione has been examined in small Phase 2 trials in Parkinson's disease, motivated by documented glutathione depletion in the substantia nigra of affected patients. - **Chronic fatigue and oxidative-stress conditions.** Research and clinical use in conditions associated with elevated oxidative stress, including some autoimmune and post-viral contexts. - **General antioxidant support.** IV glutathione is widely offered in wellness and "IV therapy" clinics; peer-reviewed outcome data for this context are limited. ## The Empowerment Angle: Quality of Life Research Many people exploring glutathione aren't looking for a miracle antioxidant. They're thinking about: - **Understanding their own antioxidant biology** — redox buffering, detoxification, and how lifestyle shapes glutathione status - **Supporting liver and detoxification pathways** as part of broader metabolic health - **Working with knowledgeable clinicians** when IV glutathione is part of a plan — this is an area where clinical literacy and provider partnership matter especially - **Taking an active role in healthspan** through methods with strong underlying biology (precursors, diet, sleep, exercise) as well as direct supplementation - **Contributing to citizen-science understanding** of how different routes (oral, liposomal, IV, intranasal, precursor strategies like NAC) actually translate into cellular effects The philosophy here is *informed clinical literacy* — understanding your own biology well enough to ask good questions, evaluate route-specific evidence, and collaborate with a provider when relevant. ## State of the Evidence **Important context**: Glutathione biology itself is thoroughly established — it is one of the most-studied molecules in biochemistry. Clinical evidence for exogenous supplementation, however, varies sharply by route and indication. - IV glutathione has the thinnest peer-reviewed outcome literature relative to how it's marketed in clinics - Precursor strategies (NAC, selenium, cysteine-rich foods) have more robust evidence in most systemic indications - Topical and oral formulations have moderate dermatology literature - Glutathione is not FDA-approved for non-acute indications; NAC, its precursor, has FDA-approved uses including acetaminophen overdose - Bioavailability of oral glutathione has been a long-standing open question, with liposomal formulations showing better delivery in some studies This is an honest picture — the underlying biology is rock-solid, while route-specific evidence varies. Intelligent engagement means matching the route and indication to the actual literature. ## Approaching Research Responsibly If you're exploring glutathione, the most empowered approach combines clinical literacy with curiosity: > **Practical Framework** > > 1. **Learn the biology first** — Understanding redox buffering, Phase II detoxification, cysteine as the limiting amino acid, and why precursor strategies often outperform direct supplementation gives you real context > 2. **Set clear, measurable outcomes** — relevant labs (liver enzymes, oxidative stress markers where available), dermatologic documentation, or specific symptom tracking > 3. **Work with a knowledgeable provider for IV routes** — IV glutathione is a clinical procedure, and collaboration with an informed clinician is the sensible path > 4. **Build on strong foundations** — sleep, regular exercise, cysteine-containing foods, selenium status, and reduced oxidative-stress exposures are the primary drivers of glutathione biology > 5. **View it as educational research** — the goal is understanding your own antioxidant and detoxification biology, not outsourcing it to a single supplement or IV bag The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed engagement with your own biochemistry**. *This entry was rewritten to help you understand both the science and the human motivation behind researching Glutathione. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Pizzorno J. Glutathione! — (2014) - Sonthalia S et al. Glutathione as a skin whitening agent: facts, myths, evidence and controversies — (2016) doi:10.4103/0378-6323.179088 - Honda Y et al. Efficacy of glutathione for the treatment of nonalcoholic fatty liver disease — (2017) doi:10.1186/s12876-017-0652-3 --- # Peptide: Gonadorelin URL: https://peptide-research.org/directory/gonadorelin Category: Sexual Health Status: Research compound Last reviewed: 2026-05-10 Aliases: Gonadorelin Acetate, GnRH, LHRH Summary: A synthetic form of gonadotropin-releasing hormone studied and used to probe or stimulate pituitary LH and FSH release in reproductive endocrinology. ## Overview Gonadorelin is synthetic GnRH, the hypothalamic decapeptide that tells the pituitary to release LH and FSH. It is a reproductive-axis tool rather than a general-purpose peptide. ## The Science GnRH biology depends strongly on pulsatility. Pulsed exposure can stimulate gonadotropin release, while continuous exposure can desensitize the axis. - **Pituitary testing** - assessing LH/FSH reserve and responsiveness. - **Fertility research** - pulsatile GnRH can be relevant in selected hypothalamic contexts. - **Feedback biology** - sex steroids and pituitary state change the response. ## Evidence Snapshot Gonadorelin is best read through endocrine timing and feedback. The same molecule can have different effects depending on pulse pattern and baseline hormone state. > **Research Lens** > > With GnRH, timing is pharmacology. A product name alone tells you very little without the administration pattern. --- # Peptide: HCG URL: https://peptide-research.org/directory/hcg Category: Sexual Health Status: FDA-approved Last reviewed: 2026-05-10 Aliases: Human Chorionic Gonadotropin, hCG Compound class: Glycoprotein hormone Summary: A glycoprotein hormone used clinically in fertility and endocrine contexts and discussed in peptide-adjacent markets because it acts on LH/CG receptor signaling. ## Overview HCG is human chorionic gonadotropin, a glycoprotein hormone produced during pregnancy and used medically in reproductive endocrinology. It is not a small research peptide, but it is often marketed beside peptide products because it is an injectable hormone. ## The Science HCG activates the same receptor family targeted by luteinizing hormone. In males, that can stimulate Leydig-cell testosterone production. In fertility medicine, HCG is used in ovulation induction and related reproductive protocols. - **Reproductive endocrinology** - ovulation induction and fertility support under medical supervision. - **Testicular function research** - LH/CG receptor stimulation and intratesticular testosterone. - **Hormone-axis literacy** - interpretation requires understanding feedback between hypothalamus, pituitary, gonads, and sex steroids. ## Evidence Snapshot HCG has legitimate clinical uses, but wellness or bodybuilding claims often detach it from the monitoring and indication-specific context that make hormone therapy interpretable. > **Research Lens** > > Because HCG is a hormone, useful research focuses on labs, indication, receptor biology, and medical supervision rather than treating it like a general-purpose peptide. --- # Peptide: Hexarelin URL: https://peptide-research.org/directory/hexarelin Category: Growth Hormone Status: Research compound Last reviewed: 2026-05-10 Aliases: Hexarelin Acetate, Examorelin Summary: A synthetic growth hormone secretagogue peptide studied for potent ghrelin-receptor-mediated GH release, with broader endocrine and cardiovascular research interest. ## Overview Hexarelin is a synthetic growth hormone secretagogue in the GHRP family. It is generally considered more potent and less selective than ipamorelin. ## The Science Hexarelin activates growth hormone secretagogue receptors, stimulating pituitary GH release. - **GH pulses** - strong GH secretagogue activity. - **Endocrine spillover** - older GHRPs may affect prolactin, cortisol, or other axes depending on context. - **Cardiac research** - some literature explores GH-independent cardiovascular effects. ## Evidence Snapshot Hexarelin is a research peptide, not an approved anti-aging product. Its potency makes endocrine monitoring and receptor selectivity central to interpretation. > **Research Lens** > > Compare hexarelin with ipamorelin and GHRP-6 to understand the tradeoff between potency and selectivity. --- # Peptide: HGH URL: https://peptide-research.org/directory/hgh Category: Growth Hormone Status: FDA-approved Last reviewed: 2026-05-10 Aliases: Human Growth Hormone, Somatropin, rhGH Compound class: Protein hormone Summary: Recombinant human growth hormone used clinically for defined growth-hormone deficiency and wasting indications, with major monitoring, abuse, and endocrine-risk considerations. ## Overview HGH is human growth hormone, a 191-amino-acid protein hormone. Recombinant somatropin is an approved medicine for specific endocrine and wasting indications. ## The Science Growth hormone acts directly through GH receptors and indirectly through IGF-1 production, especially in the liver. - **Growth and development** - pediatric GH deficiency and growth disorders. - **Body composition** - lipolysis, lean mass, fluid balance, and connective tissue effects. - **Metabolic monitoring** - glucose handling, IGF-1, edema, and soft-tissue symptoms matter. ## Evidence Snapshot HGH has legitimate medical uses, but anti-aging and physique claims often detach it from diagnosis and monitoring. It is also doping-relevant. > **Important Context** > > HGH is a protein hormone, not a casual research peptide. IGF-1, glucose, cancer-history context, and clinical indication matter. --- # Peptide: HMG URL: https://peptide-research.org/directory/hmg Category: Sexual Health Status: FDA-approved Last reviewed: 2026-05-10 Aliases: Human Menopausal Gonadotropin, Menotropins Compound class: Gonadotropin hormone preparation Summary: A gonadotropin preparation containing FSH and LH activity, used clinically in fertility medicine and discussed in peptide-adjacent endocrine markets. ## Overview HMG stands for human menopausal gonadotropin, commonly called menotropins. It is not a simple peptide; it is a gonadotropin preparation with follicle-stimulating hormone and luteinizing hormone activity. ## The Science HMG acts through reproductive hormone receptors rather than through the peptide-repair or metabolic pathways common elsewhere in this library. - **FSH activity** - supports follicular development and spermatogenesis contexts. - **LH activity** - supports steroidogenic signaling. - **Fertility protocols** - used under carefully monitored reproductive-medicine settings. ## Evidence Snapshot HMG has real clinical use, but it is a hormone preparation requiring monitoring. It should not be interpreted like a low-risk research peptide. > **Research Lens** > > Fertility hormones are dose-, timing-, and monitoring-dependent. The protocol context is part of the evidence. --- # Peptide: Humanin URL: https://peptide-research.org/directory/humanin Category: Longevity Status: Research compound Last reviewed: 2026-05-10 Aliases: Mitochondrial-derived peptide Humanin, HN Summary: A mitochondrial-derived peptide studied for cellular stress resistance, apoptosis modulation, metabolic aging, neuroprotection, and mitochondrial communication. ## Overview Humanin is a mitochondrial-derived peptide first identified through neuroprotection research. It is part of a growing field studying peptides encoded by short open reading frames in mitochondrial or nuclear genomes. ## The Science Humanin is studied as a stress-response signal with effects in cell survival and metabolic models. - **Cell survival signaling** - apoptosis and stress resistance. - **Mitochondrial communication** - how mitochondria signal beyond energy production. - **Aging models** - metabolic, vascular, and neurodegenerative research contexts. ## Evidence Snapshot Humanin is a research peptide with broad preclinical interest. Human translation remains much less established than the mechanistic literature. > **Research Lens** > > Humanin belongs with MOTS-c conceptually: both are mitochondrial-derived peptide research topics. --- # Peptide: IGF-1 LR3 URL: https://peptide-research.org/directory/igf-1-lr3 Category: Growth Hormone Status: Research compound Last reviewed: 2026-04-17 Aliases: Long R3 IGF-1, Insulin-like Growth Factor-1 LR3 Summary: A modified analog of insulin-like growth factor 1 engineered with a dramatically longer active window, widely used as a research reagent for studying anabolic signaling, muscle biology, and the downstream effects of the GH/IGF-1 axis. ## Overview **It's completely reasonable — and intelligent — to be curious about IGF-1 LR3.** > **Educational Note** > > Curiosity about how your body builds, repairs, and maintains muscle tissue is one of the most fundamental questions in human biology. IGF-1 LR3 sits at the heart of that conversation — a research tool that has shaped how scientists understand the growth hormone axis for three decades. IGF-1 LR3 (Long R3 IGF-1) is a modified analog of insulin-like growth factor 1, the primary mediator of growth hormone's anabolic effects. Two engineered changes distinguish it from native IGF-1: a 13-amino-acid N-terminal extension and a substitution of arginine for glutamate at position 3. These modifications dramatically reduce binding to IGF-binding proteins (IGFBPs), yielding sustained free-IGF activity and a much longer effective half-life. People researching LR3 are typically trying to understand something meaningful: how anabolic signaling works, how tissue repair is coordinated, and how the GH/IGF-1 axis shapes body composition, recovery, and metabolic health. ## The Science: Sustained IGF-1 Signaling Think of IGF-1 in the body like a messenger that normally gets intercepted quickly. Native IGF-1 has a half-life of about 20 minutes because binding proteins (IGFBPs) capture it almost as soon as it's released. LR3 is engineered to slip past those binding proteins. Here's what happens mechanistically: - **IGF-1 receptor activation**: Like native IGF-1, LR3 activates the IGF-1R tyrosine kinase, triggering PI3K/Akt and MAPK pathways that drive cell growth, protein synthesis, and survival. - **Reduced IGFBP sequestration**: The position-3 arginine substitution lowers affinity for IGFBP-3 and related binding proteins, leaving more free peptide available to engage the receptor. - **Extended activity window**: In cell culture, a single LR3 exposure produces anabolic effects that persist substantially longer than native IGF-1 under matched conditions. - **Insulin receptor crosstalk**: At high concentrations LR3 can also engage the insulin receptor, producing hypoglycemic effects — a key consideration in interpreting its biology. ## What Researchers Have Observed The current evidence base spans cell culture and rodent models: - **Cell culture applications**: LR3 is widely used as a research reagent in mammalian cell culture where sustained IGF-1 signaling is desired — one of its primary legitimate applications in biotechnology. - **Skeletal muscle research**: Rodent studies have examined LR3 in models of muscle hypertrophy, atrophy prevention, and protein turnover. - **Insulin sensitivity**: Because IGF-1 LR3 retains insulin-like activity, it has been studied in the context of insulin resistance and glucose handling. - **GH axis research**: LR3 is used experimentally to probe IGF-1's downstream effects independent of pulsatile GH secretion. These findings matter because IGF-1 signaling sits at the intersection of growth, repair, metabolism, and aging — pathways that many researchers believe deserve deeper understanding. ## The Empowerment Angle: Quality of Life Research Many people researching IGF-1 LR3 aren't chasing a shortcut. They're trying to understand: - **How anabolic signaling actually works** in their own body - **The relationship between GH, IGF-1, and body composition** over time - **Why recovery capacity changes with age** and what mediates it - **The biology behind resistance training adaptation** - **How to document and interpret their own metabolic responses** rather than relying on generic advice This is citizen science at its most thoughtful — learning the underlying pathways (PI3K/Akt, MAPK, IGFBP regulation) so that lab work, training data, and subjective observations can be interpreted in context. ## State of the Evidence **Important context**: IGF-1 LR3 is primarily a laboratory reagent, not a therapeutic. - Human pharmacology data are sparse - Not FDA-approved for any indication - Mecasermin (full-length recombinant IGF-1) is the approved form for severe primary IGF-1 deficiency - Sustained systemic IGF-1 elevation is biologically distinct from pulsatile physiologic signaling - Long-term human safety and cell-proliferation implications are not well characterized This doesn't make the mechanism uninteresting — it means we're in the "understanding the biology" phase. LR3's value in research has always been as a tool for learning about IGF-1 signaling, not as a finished therapeutic. ## Approaching Research Responsibly If you're researching this compound, the most grounded approach combines curiosity with care: > **Practical Framework** > > 1. **Learn the biology first** — Understanding IGF-1R, IGFBP regulation, the PI3K/Akt and MAPK pathways, and the insulin-IGF crosstalk gives you real context for anything you observe. > 2. **Set clear, measurable outcomes** — What specifically are you hoping to learn? (body composition changes, recovery metrics, fasting glucose, IGF-1 serum levels) > 3. **Start conservatively and document thoroughly** — track training load, sleep, nutrition, glucose response, and subjective recovery alongside any objective markers. > 4. **Build on foundational habits first** — resistance training, adequate protein, sleep, and recovery remain the primary drivers of the adaptations people associate with IGF-1 signaling. > 5. **View it as educational research** — the goal is understanding your own physiology, not chasing a number. The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry is designed to help you understand both the science and the human motivation behind researching IGF-1 LR3. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - King R et al. Production and characterization of recombinant IGF-1 Long R3 as a reagent — (1993) - Francis GL et al. Insulin-like growth factor (IGF)-I and IGF-I analogues: circulating forms, biological activity, and potential therapeutic use — (1998) doi:10.1677/joe.0.1590001 --- # Peptide: Ipamorelin URL: https://peptide-research.org/directory/ipamorelin Category: Growth Hormone Status: Research compound Last reviewed: 2026-04-17 Aliases: NNC 26-0161 Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2 Summary: A synthetic pentapeptide that gently nudges the pituitary to release its own growth hormone — studied for clean, selective GH pulses without the cortisol or prolactin effects of earlier secretagogues. ## Overview **It's completely reasonable — and intelligent — to be curious about Ipamorelin.** > **Educational Note** > > Wanting to understand how your own endocrine system works — how growth hormone is released, how it changes with age, and how recovery and body composition connect to it — is one of the most grounded questions a person can ask. Ipamorelin has been a favorite research tool for exploring those questions for over 25 years. Ipamorelin is a short synthetic pentapeptide in the growth hormone secretagogue (GHS) family, alongside GHRP-2, GHRP-6, and hexarelin. It was characterized in the late 1990s by Novo Nordisk and remains widely used as a research tool compound for probing the GH axis. What made it stand out from earlier secretagogues was its selectivity: it triggered GH pulses without the collateral cortisol and prolactin surges that complicated earlier compounds. People researching ipamorelin are often thinking about the same thing endocrinologists do — what pulsatile, physiologic GH release actually does, and how it differs from continuous exogenous GH. ## The Science: Prompting the Pituitary Think of GHSR-1a (the growth hormone secretagogue receptor) as a doorbell on the pituitary. Endogenous ghrelin rings it naturally; ipamorelin rings the same bell with carefully engineered selectivity. When GHSR-1a is activated: - **Pulsatile GH release**: The pituitary secretes a pulse of growth hormone — similar in shape to natural nocturnal GH bursts. - **Clean selectivity**: Unlike older GHS compounds, ipamorelin does not meaningfully activate the HPA axis — cortisol, prolactin, and ACTH stay near baseline. - **Ghrelin-receptor biology beyond GH**: The same receptor family modulates gastrointestinal motility and appetite, which is why ipamorelin was advanced into a Phase 3 post-operative ileus program. - **Downstream IGF-1 signaling**: GH pulses drive hepatic IGF-1 production, which mediates many of the anabolic and repair-related downstream effects. ## What Researchers Have Observed Evidence spans healthy-volunteer pharmacology, preclinical work, and a substantial Phase 3 safety dataset: - **Selective GH release**: In healthy-volunteer pharmacology, ipamorelin produced dose-dependent GH release without confounding HPA-axis activation — making it an attractive research probe of pituitary function. - **Post-operative ileus (Phase 3)**: The program leveraged ghrelin-receptor effects on gastrointestinal motility. It did not meet its primary endpoint but established a substantial human safety dataset. - **Pituitary diagnostics**: GHS peptides are used in research settings to probe pituitary GH responsiveness and pulsatile-secretion physiology. - **GHRH + GHS synergy**: When combined with a GHRH analog such as CJC-1295, ipamorelin produces additive acute GH release — the basis of the commonly studied "GHRH + GHS" stack. - **Somatopause research**: Academic interest continues around whether physiologic pulsatile stimulation is preferable to exogenous recombinant GH in age-related GH decline. ## The Empowerment Angle: Quality of Life Research Many people researching ipamorelin aren't chasing a pharmaceutical shortcut. They're trying to understand: - **How their own GH axis behaves** at their current life stage - **The difference between pulsatile and continuous endocrine signaling** — a distinction that matters across almost all hormones - **Why sleep, exercise, and body composition all affect GH output** and what this implies for healthspan - **How to track and interpret biomarkers** (IGF-1, fasting glucose, body composition) thoughtfully - **What aging actually means at the endocrine level** rather than accepting vague decline This is educational self-experimentation grounded in the real biology of a well-characterized system. ## State of the Evidence Ipamorelin has one of the more solid evidence bases among research-grade peptides: - Well-characterized pharmacology from healthy-volunteer studies - A substantial human safety dataset from the Phase 3 ileus program - Not approved for any clinical indication - Appears on the WADA Prohibited List - Long-term effects of sustained pulsatile GHS use in healthy adults are not well characterized Because the GH axis is tightly feedback-regulated, pulsatile stimulation via GHS agents produces different biology than continuous recombinant GH exposure — a distinction that matters when interpreting effect claims. ## Approaching Research Responsibly If you're researching this compound, the most grounded approach combines curiosity with care: > **Practical Framework** > > 1. **Learn the biology first** — Understanding GHSR-1a, pulsatile GH release, the GHRH/GHS axis, and downstream IGF-1 signaling gives you real context for anything you observe. > 2. **Set clear, measurable outcomes** — IGF-1 serum levels, body composition, sleep quality, recovery — what specifically are you trying to learn? > 3. **Start conservatively and document thoroughly** — track sleep architecture, fasting glucose, training load, and recovery alongside objective markers. > 4. **Build on foundational habits first** — sleep (especially slow-wave sleep), resistance training, and adequate protein are the primary drivers of natural GH output. > 5. **View it as educational research** — understanding your endocrine system is the goal, not chasing a number. The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry is designed to help you understand both the science and the human motivation behind researching ipamorelin. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Raun K et al. Ipamorelin, the first selective growth hormone secretagogue — (1998) doi:10.1530/eje.0.1390552 - Beck DE et al. A phase 3 study of ipamorelin for postoperative ileus — (2014) doi:10.1007/s11605-013-2411-2 --- # Peptide: Kisspeptin-10 URL: https://peptide-research.org/directory/kisspeptin-10 Category: Sexual Health Status: Research compound Last reviewed: 2026-05-10 Aliases: KP-10, Metastin fragment Sequence: YNWNSFGLRF Summary: A short kisspeptin fragment studied for hypothalamic GnRH stimulation, reproductive hormone signaling, puberty biology, and fertility research. ## Overview Kisspeptin-10 is a short active fragment of kisspeptin, a peptide family central to reproductive hormone signaling. It is studied because kisspeptin neurons help regulate GnRH release from the hypothalamus. ## The Science Kisspeptin sits upstream of the reproductive hormone cascade. - **GnRH stimulation** - kisspeptin can trigger hypothalamic GnRH release. - **LH/FSH response** - downstream pituitary signaling changes can follow. - **Fertility research** - studied as a way to probe or stimulate reproductive-axis function. ## Evidence Snapshot Kisspeptin-10 is a useful endocrine research tool, but reproductive-axis interventions require careful interpretation of timing, sex, baseline hormone status, and feedback loops. > **Research Lens** > > Kisspeptin research is upstream hormone-axis research. LH, FSH, sex steroids, and cycle timing all change how results should be read. --- # Peptide: KLOW URL: https://peptide-research.org/directory/klow Category: Blends Status: Blend Last reviewed: 2026-04-17 Aliases: Compounded recovery & skin blend Summary: A compounded peptide blend that combines KPV, GHK-Cu, BPC-157, and TB-500 — studied individually for tissue repair, inflammation modulation, and skin quality, and packaged together in compounding-pharmacy contexts. ## Overview **It's completely reasonable — and intelligent — to be curious about KLOW.** > **Educational Note** > > Tissue repair, inflammation control, and skin health sit at the intersection of almost everyone's quality-of-life questions. KLOW is interesting precisely because it bundles four peptides that researchers have studied individually for years — giving you a chance to learn about multiple regenerative pathways at once. "KLOW" is an acronym applied to compounded peptide blends — most commonly combining **K**PV, GH**K**-Cu, **L**ow-dose BPC-157, and t**OW** (TB-500 / thymosin β4 fragment). Formulations vary between compounding pharmacies and suppliers. The blend is positioned as a multi-mechanism support for tissue repair, inflammation modulation, and skin quality. People researching KLOW are typically trying to understand how different repair pathways — inflammation control, angiogenesis, cell migration, matrix remodeling — interact in real biology. ## The Science: Four Peptides, Four Angles Think of KLOW as a "multi-instrument ensemble" rather than a single-mechanism drug. Each component targets a different part of the repair-and-regeneration system: - **KPV** — A tripeptide fragment (Lys-Pro-Val) of α-MSH studied for anti-inflammatory effects in colitis and dermatology models. Research focus: mucosal inflammation, skin inflammation, NF-κB signaling. - **GHK-Cu** — A copper-binding tripeptide (Gly-His-Lys with Cu²⁺) with decades of cosmetic and wound-healing literature. Research focus: skin regeneration, hair follicle biology, wound healing. - **BPC-157** — The gastric pentadecapeptide discussed elsewhere in this library. Research focus: tissue protection and healing, particularly in musculoskeletal and gastrointestinal contexts. - **TB-500** — The LKKTETQ fragment of thymosin β4 discussed elsewhere in this library. Research focus: cell migration, tissue repair, angiogenesis. The intuition behind the blend is that tissue repair is never a single-pathway event — inflammation needs to be controlled while new vasculature forms, while cells migrate, while the extracellular matrix is rebuilt. ## What Researchers Have Observed (by component) - **Skin quality and wound healing**: GHK-Cu has the most mature literature here — improved wound closure in preclinical and clinical skin models, and established cosmetic use in peptide serums. KPV adds anti-inflammatory activity in dermatologic contexts. - **Tendon, ligament, and soft-tissue repair**: Rodent literature on BPC-157 and Tβ4-derived peptides describes accelerated healing in musculoskeletal injury models. - **Gastrointestinal inflammation**: KPV and BPC-157 have both been studied in colitis models, suggesting complementary anti-inflammatory mechanisms. - **Angiogenesis and microvascular repair**: Both BPC-157 and TB-500 have angiogenic effects in rodent models, potentially supportive of tissue recovery after injury. - **Hair follicle biology**: GHK-Cu and Tβ4-derived peptides both have literature in this area. ## The Empowerment Angle: Quality of Life Research Many people researching KLOW aren't looking for a magic recovery tool. They're exploring: - **How inflammation and repair actually coordinate** — a set of pathways that affect almost every chronic condition - **Whether layered interventions can be studied thoughtfully** rather than in isolation - **Their own recovery patterns** — wound healing, joint recovery, skin quality — with a more informed lens - **The difference between single-mechanism and multi-mechanism approaches** in biology - **Documenting their experience carefully** as a form of citizen science Learning about NF-κB signaling, copper peptide biology, thymosin-β4 chemistry, and wound-healing cascades gives anyone researching this compound a much richer framework for interpreting observations. ## State of the Evidence **Important context**: There is no peer-reviewed pharmacology on the KLOW blend as a unit — only on its individual components, each studied separately. - Component ratios vary between compounders, making cross-source comparison difficult - The strongest component-level evidence is for GHK-Cu in skin and wound healing - The others are largely preclinical - None of the constituents are FDA-approved at the concentrations used in these blends - Several appear on the WADA Prohibited List This means research on KLOW is essentially research on four separate peptides being studied simultaneously. Thoughtful documentation matters more here than with single-compound research. ## Approaching Research Responsibly If you're researching this blend, the most grounded approach combines curiosity with care: > **Practical Framework** > > 1. **Learn the biology of each component first** — KPV's NF-κB effects, GHK-Cu's copper chemistry, BPC-157's angiogenic activity, and TB-500's cell-migration role each deserve their own understanding. > 2. **Set clear, measurable outcomes** — what specifically are you tracking? (wound healing time, joint recovery, skin quality, subjective markers) > 3. **Start conservatively and document thoroughly** — because this is a multi-component blend, careful logging is the only way to interpret observations. > 4. **Build on foundational habits first** — sleep, nutrition (especially protein), resistance training, and stress management remain the primary drivers of tissue repair. > 5. **View it as educational research** — the goal is learning how repair biology works, not chasing a single outcome. The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry is designed to help you understand both the science and the human motivation behind researching KLOW. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Pickart L, Margolina A. Regenerative and protective actions of the GHK-Cu peptide — (2018) doi:10.3390/ijms19071987 - Reich J et al. KPV as an anti-inflammatory tripeptide — (2019) doi:10.1152/ajpgi.00290.2018 --- # Peptide: KPV URL: https://peptide-research.org/directory/kpv Category: Healing & Recovery Status: Research compound Last reviewed: 2026-04-17 Aliases: Lys-Pro-Val, α-MSH(11-13) Sequence: Lys-Pro-Val Summary: A short tripeptide derived from α-melanocyte-stimulating hormone, studied for anti-inflammatory effects in gut, skin, and ocular tissue — without the pigmentation activity of its parent hormone. ## Overview **It's completely reasonable — and intelligent — to be curious about KPV.** > **Educational Note** > > Chronic inflammation is increasingly recognized as a thread running through many of the conditions that affect quality of life — gut health, skin health, autoimmunity, recovery. KPV is a compelling research tool because it isolates a specific anti-inflammatory mechanism in a remarkably small molecule. KPV is a tripeptide (Lys-Pro-Val) corresponding to the C-terminal residues 11–13 of α-melanocyte-stimulating hormone (α-MSH), an endogenous anti-inflammatory peptide. Research interest centers on its retention of α-MSH's anti-inflammatory activity without the melanogenic (pigmentation) effects mediated by larger fragments — a useful pharmacologic separation for inflammatory-disease research. People researching KPV are typically trying to understand inflammation at a mechanistic level — how NF-κB signaling drives so much of what we experience as "feeling inflamed," and how specific peptides can modulate that signaling. ## The Science: Calming the NF-κB Loop Think of NF-κB as the master "turn on inflammation" switch in your cells. When it's activated, it drives production of cytokines (TNF-α, IL-6, IL-8) that coordinate the inflammatory response — useful in acute contexts, problematic when chronic. KPV's mechanism is elegant: - **NF-κB pathway inhibition**: In cell and tissue models, KPV reduces NF-κB-driven inflammatory gene expression, a central pathway in chronic inflammation. - **Pro-inflammatory cytokine reduction**: Decreases TNF-α, IL-6, and IL-8 production in stimulated cell cultures and animal disease models. - **Melanocortin-receptor-independent activity**: Evidence suggests KPV can act intracellularly rather than exclusively through MC receptors, distinguishing it from longer α-MSH fragments. - **No pigmentation effects**: Unlike α-MSH and melanotropic analogs, KPV does not meaningfully activate MC1R skin pigmentation pathways. The pharmacologic cleanliness — anti-inflammatory activity without pigmentation — is exactly what makes KPV interesting as a research compound. ## What Researchers Have Observed The preclinical evidence base spans several inflammatory contexts: - **Inflammatory bowel disease**: Rodent colitis models consistently show reductions in inflammation, tissue damage, and weight loss with KPV administration — one of the most-studied applications. - **Skin inflammation**: Preclinical work has examined KPV in atopic dermatitis and psoriasis-like models, reporting reductions in local inflammatory markers. - **Ocular inflammation**: Studies have examined topical KPV in models of conjunctivitis and ocular surface inflammation. - **Wound healing in inflammatory contexts**: Research on diabetic and chronic inflammatory wound models suggests KPV may improve healing through inflammation control rather than direct growth-factor activity. - **Compounded blends**: KPV is a common constituent of compounded peptide blends (such as KLOW) that target inflammatory and tissue-repair contexts. ## The Empowerment Angle: Quality of Life Research Many people researching KPV aren't looking for a quick fix. They're trying to understand: - **How chronic inflammation actually shows up** in their own biology — gut symptoms, skin conditions, recovery quality - **Why NF-κB signaling matters** across so many conditions - **The difference between targeted and broad anti-inflammatory approaches** (and why that distinction affects side-effect profiles) - **How mucosal and barrier biology work** — a set of systems that have become central to modern health science - **Their own inflammatory patterns** with more informed tracking Learning about melanocortin biology, cytokine signaling, and mucosal immunity turns KPV research into a doorway to understanding a much bigger set of pathways. ## State of the Evidence KPV has a reasonable preclinical base, particularly in gut-inflammation models: - Solid preclinical evidence in rodent colitis - Limited human clinical trials specific to the tripeptide itself - Broader α-MSH and melanocortin analog clinical history exists but is adjacent, not directly translatable - Not FDA-approved; research use is the predominant context in published literature - Long-term human pharmacokinetic data is minimal This is the "understanding the mechanism" phase of research. KPV's mechanistic clarity is one reason it remains an active research target. ## Approaching Research Responsibly If you're researching this compound, the most grounded approach combines curiosity with care: > **Practical Framework** > > 1. **Learn the biology first** — NF-κB signaling, α-MSH derivatives, mucosal immunity, and cytokine biology all give you meaningful context for what KPV does. > 2. **Set clear, measurable outcomes** — what specifically are you tracking? (GI symptom scores, skin quality, inflammatory biomarkers, subjective recovery) > 3. **Start conservatively and document thoroughly** — inflammatory markers vary substantially day-to-day, so good logging matters. > 4. **Build on foundational habits first** — sleep, diet quality, stress management, and adequate micronutrients drive most chronic inflammation outcomes. > 5. **View it as educational research** — the goal is understanding inflammation biology, not chasing a single symptom resolution. The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry is designed to help you understand both the science and the human motivation behind researching KPV. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Dalmasso G et al. The tripeptide KPV reduces colitis in rats — (2008) doi:10.1053/j.gastro.2007.11.011 - Brzoska T et al. α-MSH and related tripeptides: biochemistry, anti-inflammatory and protective effects — (2008) doi:10.1210/er.2007-0027 - Reich J et al. KPV as an anti-inflammatory tripeptide — (2019) doi:10.1152/ajpgi.00290.2018 --- # Peptide: L-Carnitine URL: https://peptide-research.org/directory/l-carnitine Category: Metabolic Status: FDA-approved Last reviewed: 2026-05-10 Aliases: Levocarnitine, Carnitine Compound class: Amino acid derivative Summary: An amino acid derivative involved in fatty-acid transport into mitochondria, used medically for carnitine deficiency and studied for metabolism, exercise, and body composition. ## Overview L-Carnitine is not a peptide. It is an amino acid derivative that helps shuttle long-chain fatty acids into mitochondria for beta-oxidation. ## The Science Carnitine biology is real and essential, but that does not mean every injectable or supplement claim is proven. - **Mitochondrial fatty-acid transport** - carnitine is part of the transport system. - **Deficiency treatment** - levocarnitine has legitimate medical use in deficiency contexts. - **Body composition research** - studies show mixed-to-modest results depending on population and design. ## Evidence Snapshot L-Carnitine has stronger evidence as a nutrient/deficiency molecule than as a broad fat-loss product. Route, dose, baseline status, and population matter. > **Research Lens** > > For carnitine, separate deficiency replacement, sports supplementation, and injectable wellness marketing. They are different evidence questions. ## Citations - Talenezhad N et al. L-carnitine supplementation and body composition: systematic review and meta-analysis — (2020) doi:10.1016/j.clnesp.2020.03.008 --- # Peptide: Lemon Bottle URL: https://peptide-research.org/directory/lemon-bottle Category: Metabolic Status: Blend Last reviewed: 2026-05-10 Aliases: Lemon Bottle fat dissolving, Lemon Bottle skin booster Compound class: Cosmetic blend Summary: A non-peptide cosmetic injection product marketed for localized fat reduction or skin aesthetics, with formulation and regulatory status varying by market. ## Overview Lemon Bottle is not a peptide. It is a cosmetic product label used for injectable aesthetic products marketed around localized fat reduction or skin appearance. ## The Science The key issue is product identity. Lemon Bottle formulations and claims can vary by market, supplier, and product line. - **Aesthetic injection claims** - localized fat-reduction and skin-booster marketing. - **Ingredient verification** - the exact contents must be confirmed from reliable labeling. - **Regulatory context** - cosmetic injection products may not have the same evidence or oversight as approved drugs. ## Evidence Snapshot Lemon Bottle belongs in product-literacy coverage, not peptide pharmacology. Claims should be evaluated through ingredient identity, regulatory status, sterility, injector skill, and adverse-event reporting. > **Important Context** > > Injectable cosmetic products can cause real harm even when they are not prescription drugs. Verification and clinical oversight matter. --- # Peptide: Lipo-C URL: https://peptide-research.org/directory/lipo-c Category: Metabolic Status: Blend Last reviewed: 2026-05-10 Aliases: Lipotropic injection, MIC injection, Lipo-C without B12 Compound class: Nutrient blend Summary: A non-peptide lipotropic nutrient blend typically built around methionine, inositol, choline, and sometimes L-carnitine, with formulation-dependent claims. ## Overview Lipo-C is not a peptide. It is a loose product label for lipotropic nutrient blends, usually built around methionine, inositol, and choline, with some formulas adding L-carnitine or B vitamins. ## The Science The ingredient logic comes from liver fat handling, methylation, and nutrient metabolism. - **Choline** - phospholipid synthesis and liver biology. - **Methionine** - methylation and amino-acid metabolism. - **Inositol** - cell-signaling and metabolic research contexts. - **L-carnitine** - fatty-acid transport when included. ## Evidence Snapshot Individual nutrients have real biology, but Lipo-C injection blends are not standardized and have limited direct clinical evidence for weight loss. > **Research Lens** > > For Lipo-C, confirm the exact ingredient list first. The name alone does not define a formula. --- # Peptide: Lipo-C with B12 URL: https://peptide-research.org/directory/lipo-c-b12 Category: Blends Status: Blend Last reviewed: 2026-05-10 Aliases: MIC / Lipo-C with B12, Lipo-C + B12, Lipotropic B12 blend Compound class: Nutrient blend Summary: A non-peptide lipotropic injection blend typically built around methionine, inositol, choline, L-carnitine, and vitamin B12; formulations vary and weight-loss claims are much less established than the nutrition biology. ## Overview **It's completely reasonable - and intelligent - to be curious about Lipo-C with B12.** > **Educational Note** > > Lipo-C with B12 is not a peptide. It belongs in this library only because wellness clinics and peptide vendors often market it beside peptides. The useful research frame is nutrient metabolism and evidence literacy, not peptide pharmacology. Lipo-C with B12 is a broad product label for injectable lipotropic nutrient blends. Formulations vary, but the common idea is a mix of **MIC nutrients** - methionine, inositol, and choline - plus **L-carnitine** and **vitamin B12**. Some products include additional B vitamins or amino acids. The key distinction: the individual nutrients have real biology, but commercial weight-loss claims for injectable "lipotropic" blends are much less established than the mechanistic story often implies. ## The Science: Nutrients, Not Peptides The typical components sit in basic metabolic pathways: - **Choline** supports phospholipid synthesis, methyl-group metabolism, and liver fat handling. - **Methionine** is an essential amino acid involved in methylation chemistry through S-adenosylmethionine. - **Inositol** participates in cell-signaling pathways and is studied in metabolic and endocrine contexts. - **L-carnitine** helps shuttle long-chain fatty acids into mitochondria for beta-oxidation. - **Vitamin B12** supports red blood cell biology, nervous-system function, DNA synthesis, and one-carbon metabolism. None of that automatically proves that a mixed injection causes meaningful fat loss. Mechanism is a starting point for research, not an outcome. ## What Researchers Have Observed - **Vitamin B12.** B12 replacement is well established for deficiency and malabsorption states, with parenteral forms used medically in specific contexts. - **Choline.** Choline is an essential nutrient with clear roles in liver and cell-membrane biology. - **L-carnitine.** Meta-analyses suggest modest effects on body weight in some populations, but results vary and do not validate every injectable blend. - **MIC/Lipo-C blends.** Published clinical evidence on the exact compounded injection blends used by wellness clinics is limited and formulation-dependent. ## The Empowerment Angle: Separating Nutrient Repletion From Marketing People researching Lipo-C with B12 are often trying to understand energy, weight, fatigue, or metabolic support: - **Whether B12 helps if someone is not deficient** - **Whether lipotropic nutrients meaningfully change liver fat handling** - **How carnitine biology relates to actual fat loss** - **Why injectable delivery can sound more powerful than the evidence supports** - **How to verify what is actually in a compounded nutrient blend** This is a good place to practice disciplined interpretation: nutrients can be important without a specific commercial blend being proven. ## State of the Evidence **Important context**: Lipo-C with B12 is a nutrient blend, not a standardized drug product. - Formulations vary widely between suppliers. - B12 injections are medically meaningful in deficiency or malabsorption contexts, but that does not establish broad wellness or weight-loss benefit. - L-carnitine has mixed-to-modest body-composition evidence depending on population, dose, and study design. - Choline and other MIC nutrients have real metabolic roles, but direct evidence for injectable MIC weight-loss products is thin. - Because these are injections, sterility, compounding quality, dosing accuracy, and allergy or sensitivity risk matter. ## Approaching Research Responsibly If you're researching Lipo-C with B12, start by identifying the actual formulation: > **Practical Framework** > > 1. **Confirm the ingredient list** - "Lipo-C" is not standardized. > 2. **Separate deficiency treatment from enhancement claims** - especially for B12. > 3. **Use baseline labs where relevant** - B12, methylmalonic acid, homocysteine, liver markers, and metabolic markers may provide context. > 4. **Treat weight-loss claims cautiously** - nutrient biology is not the same as proven fat-loss efficacy. > 5. **Check compounding quality** - injectable nutrient products still require sterile handling and reliable labeling. The mature framing is that Lipo-C with B12 is a peptide-adjacent wellness product with plausible nutrient biology and limited blend-specific evidence. *This entry is designed to help you understand both the science and the human motivation behind researching Lipo-C with B12. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - NIH Office of Dietary Supplements. Vitamin B12 fact sheet for health professionals — (2024) https://ods.od.nih.gov/factsheets/VitaminB12-HealthProfessional/ - NIH Office of Dietary Supplements. Choline fact sheet for health professionals — (2022) https://ods.od.nih.gov/factsheets/Choline-HealthProfessional/ - Talenezhad N et al. L-carnitine supplementation and body composition: systematic review and meta-analysis — (2020) doi:10.1016/j.clnesp.2020.03.008 --- # Peptide: Liraglutide URL: https://peptide-research.org/directory/liraglutide Category: Metabolic Status: FDA-approved Last reviewed: 2026-05-10 Aliases: Victoza, Saxenda, GLP-1 receptor agonist Summary: A once-daily GLP-1 receptor agonist approved for type 2 diabetes and chronic weight management, with a long clinical evidence base preceding semaglutide. ## Overview Liraglutide is a GLP-1 receptor agonist and one of the major clinical predecessors to semaglutide. It is administered once daily in regulated products for diabetes and weight-management indications. ## The Science Liraglutide activates GLP-1 receptors, producing glucose-dependent insulin secretion, reduced glucagon, slowed gastric emptying, and central appetite effects. - **Diabetes research** - glycemic control and cardiometabolic endpoints. - **Weight management** - appetite and energy-intake reduction. - **GLP-1 lineage** - useful comparison point for semaglutide and newer incretin therapies. ## Evidence Snapshot Liraglutide has a substantial clinical evidence base. Research interest often focuses on how daily GLP-1 agonism compares with longer-acting weekly agents. > **Research Lens** > > Liraglutide helps put newer GLP-1 drugs in context: same pathway family, different duration, dosing, and outcome profile. --- # Peptide: LL-37 URL: https://peptide-research.org/directory/ll-37 Category: Healing & Recovery Status: Research compound Last reviewed: 2026-04-17 Aliases: Cathelicidin, hCAP-18 fragment Sequence: [LL-37, 37 aa] Summary: The only human cathelicidin antimicrobial peptide — a 37-amino-acid fragment of hCAP-18 studied for its broad antimicrobial activity, wound-healing signaling, and immunomodulatory effects across preclinical and early clinical work. ## Overview **It's completely reasonable — and intelligent — to be curious about LL-37.** > **Educational Note** > > LL-37 sits at the center of your body's first-line immune defense. Understanding how the innate immune system actually works — how your skin, lungs, and mucosa fight off pathogens before the adaptive immune system even engages — is genuinely fascinating biology. LL-37 is the C-terminal 37-amino-acid peptide produced by proteolytic cleavage of hCAP-18, the only cathelicidin antimicrobial peptide in humans. It is widely expressed in skin, mucosa, and immune cells, where it functions as a first-line antimicrobial defense molecule and as a signaling peptide in tissue repair and immune modulation. People researching LL-37 are typically trying to understand how innate immunity, chronic wound biology, and inflammatory skin conditions connect — and what it means that one peptide does all of this. ## The Science: A Swiss-Army Antimicrobial Think of LL-37 as a pocket-knife peptide: one molecule with several distinct functions that evolved to work together. - **Direct antimicrobial activity**: LL-37 disrupts bacterial, fungal, and viral membranes through an amphipathic α-helical structure that inserts into lipid bilayers — a mechanism less prone to classical antibiotic resistance than target-specific antibiotics. - **Antibiofilm activity**: Effective at concentrations below minimum inhibitory concentration against several biofilm-forming organisms, relevant to chronic wound and device-associated infections. - **Chemotaxis and immunomodulation**: Acts as a chemoattractant for neutrophils, monocytes, and T cells, and modulates cytokine production at sites of infection. - **Wound-healing signaling**: Promotes keratinocyte migration, angiogenesis, and re-epithelialization beyond its antimicrobial role. - **DNA-peptide complexes**: Interaction with self-DNA in autoimmune contexts (notably psoriasis) links LL-37 to type I interferon induction — a reminder that the same peptide can be protective in one context and pathogenic in another. ## What Researchers Have Observed The evidence base spans preclinical biology and some early clinical work: - **Chronic wound healing**: A Phase 2 trial in hard-to-heal venous leg ulcers reported improved healing with topical LL-37, motivating continued clinical development. - **Skin infection and inflammation**: Preclinical studies examine LL-37 in atopic dermatitis, acne, and rosacea, where endogenous LL-37 levels are dysregulated. - **Antibiofilm therapeutics**: Particularly for diabetic foot ulcers, osteomyelitis, and medical-device infections, LL-37 and its analogs are studied as adjuncts or alternatives to conventional antibiotics. - **Respiratory infections**: Research interest in inhaled LL-37 for cystic fibrosis and bacterial pneumonia, leveraging its antimicrobial breadth. - **Oral and periodontal health**: Mucosal immunity research covers LL-37's role in oral defense. ## The Empowerment Angle: Quality of Life Research Many people researching LL-37 aren't looking for a shortcut around antibiotics. They're exploring: - **How innate immunity actually works** — a surprisingly under-taught area of human biology - **Why chronic wounds are so difficult** and what makes a wound "stuck" - **The relationship between skin, microbiome, and inflammation** — relevant to a long list of quality-of-life conditions - **How antibiotic resistance is reshaping infection research** and where host-defense peptides fit - **Their own skin or wound biology** with a more informed framework Learning about cathelicidins, defensins, keratinocyte biology, and the interplay of antimicrobial and signaling functions gives LL-37 research real depth. ## State of the Evidence LL-37 has a well-characterized mechanistic base and a meaningful early-clinical presence: - Well-characterized basic biology - Phase 2 clinical data in chronic venous leg ulcers - Commercial development has been pursued by several groups (including Promore Pharma's wound-healing programs) - Not FDA-approved - Context-dependent effects: elevated LL-37 contributes to psoriasis and lupus pathogenesis in some contexts — a reminder that endogenous antimicrobial peptides are not universally beneficial This context-dependence is part of what makes LL-37 such a rich research target — it's not a simple "good peptide" or "bad peptide" story. ## Approaching Research Responsibly If you're researching this compound, the most grounded approach combines curiosity with care: > **Practical Framework** > > 1. **Learn the biology first** — Cathelicidin biology, innate immunity, wound-healing cascades, and the specific contexts where LL-37 is pathogenic (psoriasis, lupus) all matter. > 2. **Set clear, measurable outcomes** — what specifically are you tracking? (wound healing metrics, skin quality scores, infection-related markers) > 3. **Start conservatively and document thoroughly** — context-dependence means careful observation is especially important here. > 4. **Build on foundational habits first** — nutrition (especially vitamin D, which regulates endogenous cathelicidin expression), sleep, and glucose control drive much of innate immune function. > 5. **View it as educational research** — the goal is understanding host-defense biology, not a particular outcome. The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry is designed to help you understand both the science and the human motivation behind researching LL-37. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Vandamme D et al. A comprehensive summary of LL-37, the factotum human cathelicidin peptide — (2012) doi:10.1016/j.cellimm.2012.02.008 - Grönberg A et al. Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers — (2014) doi:10.1111/wrr.12176 - Kahlenberg JM, Kaplan MJ. Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease — (2013) doi:10.4049/jimmunol.1302005 --- # Peptide: Melanotan I URL: https://peptide-research.org/directory/melanotan-i Category: Sexual Health Status: FDA-approved Last reviewed: 2026-05-10 Aliases: MT-1, Afamelanotide, NDP-alpha-MSH Summary: A synthetic alpha-MSH analog best known through afamelanotide, a melanocortin-1 receptor agonist approved for erythropoietic protoporphyria under regulated use. ## Overview Melanotan I is a synthetic analog of alpha-melanocyte-stimulating hormone. The regulated pharmaceutical lineage is afamelanotide, a melanocortin-1 receptor agonist used for a narrow photoprotection-related indication. ## The Science Melanotan I is more MC1R-focused than Melanotan II, which is why the two should not be treated as interchangeable. - **MC1R signaling** - stimulates melanogenesis in skin melanocytes. - **Photoprotection biology** - studied in conditions where light exposure causes severe symptoms. - **Pigmentation research** - useful for understanding melanocortin receptor selectivity. ## Evidence Snapshot The strongest evidence belongs to regulated afamelanotide use, not grey-market tanning products. Research interpretation should separate approved implant products from nonstandard vial formulations. > **Research Lens** > > MT-1 and MT-2 differ meaningfully. MT-1 is primarily an MC1R pigmentation tool, while MT-2 has broader melanocortin activity. --- # Peptide: Melanotan II URL: https://peptide-research.org/directory/melanotan-ii Category: Sexual Health Status: Research compound Last reviewed: 2026-04-17 Aliases: MT-II, MT2, α-MSH analog Summary: A synthetic pan-melanocortin agonist originally developed at the University of Arizona as a sunless-tanning research candidate and later studied for central effects on sexual arousal and appetite regulation. ## Overview **It's completely reasonable — and intelligent — to be curious about Melanotan II.** > **Educational Note** > > Melanotan II has an unusually rich story — it's one of the few peptides where the full melanocortin system (pigmentation, sexual arousal, appetite) can be studied in one molecule. That broad activity is simultaneously what makes it scientifically fascinating and what makes it require real care to research. Melanotan II is a synthetic cyclic heptapeptide analog of α-melanocyte-stimulating hormone (α-MSH). It was developed in the 1980s at the University of Arizona as part of a research program to create a pharmacologic means of stimulating melanogenesis — sunless tanning — as a melanoma-prevention strategy in photosensitive individuals. It reached Phase 2 but was not advanced to commercialization; a more selective successor, afamelanotide (Scenesse), later reached approval for a narrower indication. People researching MT-II are typically interested in melanocortin pharmacology itself — a system that sits at the crossroads of pigmentation, sexual function, appetite, and energy balance. ## The Science: A Pan-Melanocortin Agonist Think of the melanocortin system as a family of receptors (MC1R through MC5R), each with distinct roles. Most pharmaceutical development has aimed at selective activation of one receptor. Melanotan II does the opposite — it activates several. - **MC1R**: Stimulates melanogenesis in skin melanocytes, producing increased eumelanin and darkened pigmentation. This is the primary source of the tanning effect. - **MC3R / MC4R**: Activation in the central nervous system affects sexual arousal, appetite, and energy homeostasis. The MC4R contribution is likely the basis of reported libido effects. - **MC5R**: Peripheral effects on exocrine function. The lack of receptor selectivity accounts for Melanotan II's broad pharmacologic profile — and also for its side-effect spectrum. More selective successor compounds (afamelanotide for MC1R, bremelanotide/PT-141 for MC4R) were developed precisely to separate these effects. ## What Researchers Have Observed Evidence spans clinical pharmacology studies and a substantial non-medical-use record: - **Skin pigmentation**: Research and clinical pharmacology studies demonstrated dose-dependent tanning. Selective successor afamelanotide is approved for erythropoietic protoporphyria in the EU and US. - **Sexual arousal**: Central MC4R activity led to research interest in sexual dysfunction — a line of work that produced the more selective FDA-approved drug PT-141 (bremelanotide). - **Appetite and body weight**: Central melanocortin signaling is a well-established appetite-regulation pathway, and Melanotan II has been used as a research tool for probing this biology. - **Photoprotection research**: The original Arizona program was motivated by melanoma prevention in high-risk populations — research that continues with afamelanotide. ## The Empowerment Angle: Quality of Life Research Many people who encounter Melanotan II are thinking about things like skin pigmentation, sexual function, or appetite. The more empowering path is understanding the underlying melanocortin system rather than focusing on a single downstream effect: - **How one peptide family regulates multiple quality-of-life dimensions** — a genuinely surprising fact of biology - **Why selective receptor targeting matters** — and how it produced successor compounds like afamelanotide and PT-141 - **The connection between skin biology and photoprotection research** - **How central appetite signaling actually works** at the receptor level This is also a case where the most empowered researchers pay attention to what's *not* known. Melanotan II's pan-agonism means any observation is hitting several systems at once, which makes interpretation harder — and the honest questions more interesting. ## State of the Evidence **Important context**: Melanotan II is a research compound that was never advanced to approval, and its non-medical use has generated a meaningful adverse-effect record that researchers should know about honestly. - Pharmacology and safety profile are partially characterized - Reported effects in research and non-medical use include nausea, facial flushing, spontaneous erections, blood-pressure changes, and uneven pigmentation (including darkening of pre-existing moles) - Published case series describe melanoma in individuals using unregulated Melanotan II, raising concern about non-selective melanocyte stimulation in people with melanoma risk factors - More selective successor compounds (afamelanotide, bremelanotide/PT-141) are the approved pharmaceutical options that inherit Melanotan II's research lineage - Purity of unregulated MT-II supplies is not controlled These aren't abstract warnings — they're the reasons the field moved toward selective compounds. Honest research means incorporating this information rather than working around it. ## Approaching Research Responsibly If you're researching this compound, the most grounded approach combines curiosity with real care: > **Practical Framework** > > 1. **Learn the biology first** — Melanocortin receptor subtypes, α-MSH physiology, melanocyte biology, and why selective successors (afamelanotide, PT-141) were developed matter here. > 2. **Set clear, measurable outcomes** — and be honest about whether a more selective approved compound (afamelanotide for pigmentation, PT-141 for sexual function) would be a more appropriate research path. > 3. **Start conservatively and document thoroughly** — especially track blood pressure, skin changes (including existing moles), and GI effects. > 4. **Build on foundational habits first** — skin health, cardiovascular fitness, sleep, and stress management remain the dominant contributors to the downstream outcomes people associate with this compound. > 5. **View it as educational research** — melanocortin biology is genuinely fascinating, and understanding it is more valuable than any particular cosmetic outcome. The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation** — and, for MT-II specifically, honest engagement with the full evidence record. *This entry is designed to help you understand both the science and the human motivation behind researching Melanotan II. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Hadley ME, Dorr RT. Melanocortin peptide therapeutics: historical milestones, clinical studies and commercialization — (2006) doi:10.1016/j.peptides.2005.10.027 - Dorr RT et al. Evaluation of melanotan-II, a superpotent cyclic melanotropic peptide — (1988) doi:10.1016/0024-3205(88)90302-0 - Rössler A et al. Cardiovascular responses to MT-II — (2006) --- # Peptide: MGF URL: https://peptide-research.org/directory/mgf Category: Growth Hormone Status: Research compound Last reviewed: 2026-05-10 Aliases: Mechano Growth Factor, IGF-1 Ec-related peptide Summary: A mechano growth factor-related peptide concept tied to IGF-1 splice-variant biology, muscle loading, tissue repair, and satellite-cell research. ## Overview MGF stands for mechano growth factor, a term linked to IGF-1 splice-variant biology and local tissue response to mechanical loading. Commercial MGF products are usually short peptide representations of a more complex biological concept. ## The Science MGF is discussed around local muscle repair rather than systemic growth-hormone replacement. - **Mechanical loading response** - interest in how muscle responds to training or injury. - **Satellite-cell biology** - repair and regeneration models. - **IGF-1 family context** - related to growth and repair signaling, but not identical to IGF-1 LR3. ## Evidence Snapshot MGF has strong conceptual appeal in muscle biology, but commercial peptide claims are often ahead of controlled human data. > **Research Lens** > > For MGF, separate endogenous splice-variant biology from the evidence for a specific synthetic product. --- # Peptide: MOTS-c URL: https://peptide-research.org/directory/mots-c Category: Longevity Status: Research compound Last reviewed: 2026-04-17 Aliases: Mitochondrial open reading frame of the 12S rRNA-c Sequence: MRWQEMGYIFYPRKLR Summary: A 16-amino-acid peptide encoded inside mitochondrial DNA itself, studied for effects on insulin sensitivity, exercise adaptation, and age-related metabolic decline — a fascinating window into mitochondrial-nuclear signaling. ## Overview **It's completely reasonable — and intelligent — to be curious about MOTS-c.** > **Educational Note** > > MOTS-c is one of the most genuinely surprising discoveries in recent metabolic biology: a peptide encoded inside mitochondrial DNA itself, released as a signaling molecule, and connected to how exercise, insulin sensitivity, and aging actually work. The story is still unfolding. MOTS-c (Mitochondrial ORF of the Twelve S rRNA-c) is a 16-amino-acid peptide encoded within the mitochondrial 12S rRNA gene. It belongs to a small class of mitochondrial-derived peptides (MDPs) that also includes humanin and the SHLPs. It was described in 2015 by researchers at the University of Southern California and has been a subject of active preclinical research since. People researching MOTS-c are typically drawn to the bigger question: how do mitochondria actually communicate with the rest of the cell and body, and how does that signaling change with age, exercise, and metabolic stress? ## The Science: A Peptide from Inside the Mitochondria Think of the mitochondrion as historically described as a "power plant" — but a power plant that also sends out letters. MOTS-c is one of those letters: a peptide encoded in mitochondrial DNA, translated, and then dispatched to influence the rest of the cell (including the nucleus). - **Nuclear translocation under metabolic stress**: MOTS-c moves into the nucleus in response to metabolic stressors and binds regulatory regions governing stress-response gene expression. - **Folate-methionine cycle regulation**: Influences the AICAR-AMPK pathway and folate metabolism, with downstream effects on cellular energy sensing. - **Insulin sensitization**: Enhances glucose uptake in skeletal muscle and hepatic tissue in rodent studies. - **Exercise coupling**: Endogenous MOTS-c levels rise with exercise, suggesting a role in the adaptive metabolic response to physical activity — one of the more intriguing findings of the past decade. ## What Researchers Have Observed The preclinical evidence base is substantial and has replicated across multiple academic groups: - **Insulin sensitivity**: In diet-induced insulin-resistant mice, MOTS-c administration improves glucose tolerance and hepatic and peripheral insulin sensitivity. - **Exercise physiology**: In aged mice, MOTS-c administration has been reported to improve running performance, grip strength, and other functional metrics that decline with age. - **Metabolic syndrome and obesity**: Rodent studies describe reductions in adiposity and improvements in lipid profiles, linked to the insulin-sensitizing mechanism. - **Bone health**: Reports suggest effects on bone density in aged-mouse models, one of the systemic aging axes where MDPs have been studied. - **Inflammation and adipose biology**: Preclinical work describes reductions in adipose tissue inflammation in metabolic-challenge models. - **Emerging interest**: Active research continues in cardiometabolic aging, exercise mimetics, and the broader biology of mitochondrial-derived signaling peptides. ## The Empowerment Angle: Quality of Life Research Many people researching MOTS-c aren't looking for a shortcut around training. They're exploring: - **How mitochondrial biology actually shapes healthspan** — arguably the most important conversation in longevity science - **Why exercise improves insulin sensitivity at the molecular level** — a story MOTS-c is genuinely part of - **Their own metabolic responses to training, fasting, and stress** with a richer framework - **The broader idea of "exercise mimetics"** and whether they're a real concept or a distraction - **Contributing to citizen science** through thoughtful documentation during a still-unfolding research story Learning about AMPK, the folate-methionine cycle, mitochondrial-nuclear signaling, and exercise-induced adaptation turns MOTS-c research into a window onto the whole metabolic-aging field. ## State of the Evidence MOTS-c has one of the stronger replication stories among research peptides: - Substantial preclinical body of work across multiple academic groups - Phase 1 human safety and pharmacokinetic data in peer-reviewed literature remain limited - Translation of rodent metabolic and exercise findings to humans is an active question - Not FDA-approved - Long-term human data is not yet available This is the "understanding a genuinely novel biology" phase. MOTS-c's broader interest comes from the fact that it's opened up a whole class of mitochondrial-derived peptides as a research area. ## Approaching Research Responsibly If you're researching this compound, the most grounded approach combines curiosity with care: > **Practical Framework** > > 1. **Learn the biology first** — Mitochondrial-derived peptides, AMPK signaling, the folate-methionine cycle, and exercise-induced endocrine responses all give you real context. > 2. **Set clear, measurable outcomes** — what specifically are you tracking? (fasting glucose, insulin sensitivity markers, exercise capacity, recovery) > 3. **Start conservatively and document thoroughly** — because human data is limited, careful personal documentation has real learning value. > 4. **Build on foundational habits first** — exercise itself is the most robust way to raise endogenous MOTS-c; sleep, diet quality, and training consistency drive most of the downstream outcomes. > 5. **View it as educational research** — the goal is understanding mitochondrial biology, not bypassing training. The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry is designed to help you understand both the science and the human motivation behind researching MOTS-c. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Lee C et al. The mitochondrial-derived peptide MOTS-c promotes metabolic homeostasis — (2015) doi:10.1016/j.cmet.2015.02.009 - Reynolds JC et al. MOTS-c is an exercise-induced mitochondrial-encoded regulator of age-dependent physical decline — (2021) doi:10.1038/s41467-020-20790-0 - Kim SJ et al. Mitochondrial-derived peptides in aging and age-related diseases — (2018) doi:10.1007/s11357-018-0007-1 --- # Peptide: NAD+ URL: https://peptide-research.org/directory/nad-plus Category: Longevity Status: Investigational Last reviewed: 2026-04-17 Aliases: Nicotinamide adenine dinucleotide Compound class: Coenzyme Summary: A central coenzyme in cellular energy, DNA repair, and sirtuin biology, studied extensively in aging and metabolic health — most commonly researched via oral precursors like nicotinamide riboside (NR) and NMN. ## Overview **It's completely reasonable — and intelligent — to be curious about NAD+.** > **Educational Note** > > NAD+ is one of the most fundamental molecules in cell biology — and one of the most visible areas of longevity research. Curiosity about why cellular NAD+ declines with age and what that means is the kind of first-principles thinking that reshapes how people understand their own biology. NAD+ (nicotinamide adenine dinucleotide) is a coenzyme found in every living cell. Strictly speaking it is a dinucleotide rather than a peptide — this library includes it because infusible NAD+ and its oral precursors (NMN, nicotinamide riboside) are widely studied and marketed in the same channels as peptide therapeutics. People researching NAD+ are typically asking a genuinely big question: can restoring one of the cell's most fundamental coenzymes influence how we age? ## The Science: A Coenzyme at the Center of Everything Think of NAD+ as cellular currency that several major systems all spend: - **Energy metabolism**: Redox reactions in glycolysis, the TCA cycle, and oxidative phosphorylation depend on NAD+/NADH cycling. - **Sirtuin activation**: NAD+ is a required substrate for the sirtuin family of deacetylases, enzymes linked to longevity pathways in multiple model organisms. - **PARP and DNA repair**: PARPs consume NAD+ during DNA damage response — linking genome maintenance directly to NAD+ availability. - **CD38 and cellular signaling**: CD38 consumes NAD+, and its activity increases with age — one of the proposed reasons NAD+ pools decline over time. Because cellular NAD+ levels decline in multiple tissues with aging, much of the research asks whether restoring NAD+ pools produces functional benefit or simply raises a biomarker. ## What Researchers Have Observed The evidence spans preclinical work and a growing clinical base: - **Mitochondrial health**: Rodent studies report improved mitochondrial function, enhanced endurance, and age-related metabolic improvements with NAD+ precursor supplementation. - **Cardiometabolic health**: Human NR trials (Martens 2018 and follow-ups) have shown elevated whole-blood NAD+ metabolites, improved blood pressure in certain populations, and favorable lipid signals. - **Muscle and physical function**: Research in older adults has examined effects on muscle strength and mitochondrial capacity, with small effect sizes emerging in some trials. - **Neurodegenerative disease**: Early-stage research explores NAD+ restoration in Parkinson's disease, Alzheimer's disease, and peripheral neuropathy. - **Skin and aging biomarkers**: Topical NAD+ precursors are an active cosmetic research area, and systemic precursors are studied against epigenetic clocks. ## The Empowerment Angle: Quality of Life Research Many people researching NAD+ aren't expecting a fountain of youth. They're exploring: - **How aging actually works at the cellular level** — the kind of literacy that changes how people approach their own health - **What sirtuin biology means** and why it's been such a durable theme in longevity research - **The relationship between energy, recovery, and cellular repair** across their own life - **Biomarker tracking** — whole-blood NAD+, metabolites, and functional measures — as a form of informed self-study - **Contributing to citizen science** through thoughtful documentation during an ongoing research story Learning about redox biology, the NAD+ salvage pathway, CD38, and sirtuins gives anyone researching NAD+ a much richer view of aging biology as a whole. ## State of the Evidence NAD+ precursors have one of the more robust human evidence bases among longevity-adjacent compounds: - Oral precursors (NR, NMN) have substantial published human safety and pharmacokinetic data - Multiple placebo-controlled trials establish that blood NAD+ metabolites rise reliably with supplementation - Consistent effects on hard clinical endpoints (functional aging, disease progression) remain early-stage - Parenteral NAD+ as administered in wellness clinics has a much thinner peer-reviewed evidence base than the oral-precursor literature - Long-term outcome data is still accumulating This is the classic "biomarker moves reliably, endpoint still being established" situation — interesting to research, worth understanding carefully. ## Approaching Research Responsibly If you're researching NAD+ or its precursors, the most grounded approach combines curiosity with care: > **Practical Framework** > > 1. **Learn the biology first** — NAD+/NADH redox, sirtuins, the salvage pathway, PARP activity, and CD38 all deserve real understanding. > 2. **Set clear, measurable outcomes** — what specifically are you tracking? (energy, exercise capacity, sleep, biomarkers like NAD+ metabolites or lipids) > 3. **Start conservatively and document thoroughly** — the oral-precursor literature is stronger than the parenteral-NAD+ literature; the research base should inform the research choice. > 4. **Build on foundational habits first** — exercise, sleep, caloric quality, and NAD+-supportive nutrients (niacin-family B3 vitamins) drive much of cellular NAD+ biology. > 5. **View it as educational research** — the real prize is understanding aging biology, not a number on a supplement label. The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry is designed to help you understand both the science and the human motivation behind researching NAD+. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Rajman L et al. Therapeutic potential of NAD-boosting molecules: the in vivo evidence — (2018) doi:10.1016/j.cmet.2018.02.011 - Martens CR et al. Chronic nicotinamide riboside supplementation is well-tolerated and elevates NAD+ in healthy middle-aged and older adults — (2018) doi:10.1038/s41467-018-03421-7 - Conlon N, Ford D. A systems-approach to NAD+ restoration — (2022) doi:10.1016/j.bcp.2022.114946 --- # Peptide: Orexin B URL: https://peptide-research.org/directory/orexin-b Category: Cognitive Status: Research compound Last reviewed: 2026-05-10 Aliases: Hypocretin-2, Orexin-B Summary: An endogenous hypothalamic neuropeptide studied for arousal, wakefulness, appetite, reward signaling, and sleep-wake regulation through orexin receptors. ## Overview Orexin B, also called hypocretin-2, is an endogenous neuropeptide produced in the hypothalamus. It is part of the orexin system, which helps regulate wakefulness, arousal, appetite, and reward-related behavior. ## The Science Orexin biology is central to sleep-wake control. Loss of orexin signaling is strongly linked to narcolepsy, while orexin receptor antagonists are used clinically for insomnia. - **Wakefulness** - orexin neurons stabilize arousal states. - **Appetite and energy balance** - hypothalamic integration of feeding and arousal. - **Reward and motivation** - orexin pathways interact with dopaminergic circuits. ## Evidence Snapshot Orexin B is a neurobiology research peptide, not a general stimulant. The broader orexin system is clinically important, but peptide products require careful distinction from approved orexin receptor drugs. > **Research Lens** > > Orexin research is about sleep-wake circuitry first. Product claims should be judged against that receptor and delivery context. --- # Peptide: Oxytocin URL: https://peptide-research.org/directory/oxytocin Category: Sexual Health Status: FDA-approved Last reviewed: 2026-05-10 Aliases: Oxytocin Acetate, Pitocin Sequence: CYIQNCPLG Summary: A cyclic nonapeptide hormone used clinically in obstetrics and studied for social bonding, lactation, reproductive physiology, and neuroendocrine signaling. ## Overview Oxytocin is an endogenous cyclic peptide hormone with major roles in labor, lactation, and social-neuroendocrine signaling. Pharmaceutical oxytocin is used in obstetric medicine. ## The Science Oxytocin receptors are expressed in reproductive tissues and parts of the nervous system. - **Uterine contraction** - clinical use in labor and postpartum bleeding contexts. - **Lactation** - milk letdown physiology. - **Social and stress research** - complex central nervous system effects that vary by context. ## Evidence Snapshot Oxytocin has clear clinical use in obstetrics, but wellness-market claims around bonding, libido, or anxiety are more complex and context-dependent. > **Research Lens** > > Oxytocin effects are context-sensitive. Social-neuroendocrine findings should not be simplified into a single "bonding hormone" claim. --- # Peptide: PE-22-28 URL: https://peptide-research.org/directory/pe-22-28 Category: Cognitive Status: Research compound Last reviewed: 2026-05-10 Aliases: Spadin analog, TREK-1-related peptide Summary: A short peptide analog discussed in neuropsychiatric research for TREK-1 potassium-channel biology, antidepressant-like mechanisms, and neuroplasticity models. ## Overview PE-22-28 is a short peptide discussed as a spadin-related analog in neuropsychiatric research. It is not an approved antidepressant; it is a research peptide tied to ion-channel and neuroplasticity hypotheses. ## The Science The research focus is TREK-1, a potassium channel implicated in neuronal excitability and mood-related signaling. - **TREK-1 modulation** - ion-channel target biology. - **Antidepressant-like models** - mostly preclinical behavioral research. - **Neuroplasticity** - interest in synaptic and stress-response pathways. ## Evidence Snapshot PE-22-28 is early-stage and mechanism-driven. Human clinical interpretation is premature without controlled studies. > **Research Lens** > > For mood-related peptides, animal behavioral signals are hypothesis-generating, not clinical proof. --- # Peptide: PEG MGF URL: https://peptide-research.org/directory/peg-mgf Category: Growth Hormone Status: Research compound Last reviewed: 2026-05-10 Aliases: PEGylated Mechano Growth Factor, PEG-MGF Summary: A PEGylated version of mechano growth factor concepts, discussed in muscle-repair and IGF-1 splice-variant research with limited clinical validation. ## Overview PEG MGF refers to a PEGylated form of mechano growth factor-related peptide products. PEGylation is used to extend exposure, but the resulting product should not be assumed equivalent to endogenous MGF biology. ## The Science MGF is commonly discussed as a local splice-variant-related signal from the IGF-1 family, associated with muscle repair and mechanical loading. - **Muscle repair models** - satellite-cell and local repair hypotheses. - **IGF-1 family context** - related conceptually to growth and repair signaling. - **PEGylation** - changes duration and pharmacokinetic behavior. ## Evidence Snapshot PEG MGF is a research-market product with limited controlled human evidence. Claims often extrapolate from IGF-1 and muscle-repair biology rather than product-specific trials. > **Research Lens** > > PEGylation changes a peptide. Treat PEG MGF and MGF as related but not interchangeable. --- # Peptide: Pinealon URL: https://peptide-research.org/directory/pinealon Category: Cognitive Status: Research compound Last reviewed: 2026-05-10 Aliases: Glu-Asp-Arg, EDR Sequence: EDR Summary: A short synthetic tripeptide from the bioregulator peptide tradition, studied mainly in neuroprotection, brain aging, and stress-response research models. ## Overview Pinealon is a synthetic tripeptide usually represented as Glu-Asp-Arg or EDR. It is discussed in the bioregulator peptide category and is most often associated with brain-aging and neuroprotection claims. ## The Science As a very short peptide, Pinealon is typically framed around cell-signaling and gene-expression hypotheses rather than classic receptor-drug pharmacology. - **Neuroprotection models** - oxidative stress, hypoxia, and neuronal resilience are common themes. - **Brain-aging research** - interest centers on cellular stress and repair pathways. - **Bioregulator framing** - evidence often comes from regional literature and preclinical systems. ## Evidence Snapshot Pinealon has limited high-quality human evidence. It should be treated as a research peptide with a hypothesis-driven literature, not as a proven cognitive intervention. > **Research Lens** > > Short bioregulator peptides require careful source reading because claims often outrun the strength and accessibility of the evidence. --- # Peptide: PNC-27 URL: https://peptide-research.org/directory/pnc-27 Category: Longevity Status: Research compound Last reviewed: 2026-05-10 Aliases: p53-derived anticancer peptide, HDM-2-binding peptide Summary: A synthetic p53-derived research peptide studied preclinically for cancer-cell membrane effects and HDM-2-related mechanisms, not an approved cancer therapy. ## Overview PNC-27 is a synthetic peptide derived from a p53 protein segment and linked to a membrane-penetrating sequence in research designs. It is discussed mostly in preclinical oncology contexts. ## The Science The proposed mechanism involves interaction with HDM-2 and selective membrane effects in cancer cells. That makes it scientifically interesting, but also means claims should be held to oncology-level evidence standards. - **p53/HDM-2 biology** - tumor suppressor pathway context. - **Cancer-cell membrane effects** - preclinical work focuses on selective tumor-cell disruption. - **Translational uncertainty** - cell and animal findings are not clinical proof. ## Evidence Snapshot PNC-27 is not an approved cancer treatment. It belongs in a research library as an example of p53-derived peptide design and the gap between preclinical signal and clinical validation. > **Important Context** > > Any cancer-related peptide claim requires extreme caution. Preclinical oncology research is not a substitute for evidence-based cancer care. --- # Peptide: PT-141 URL: https://peptide-research.org/directory/pt-141 Category: Sexual Health Status: FDA-approved Last reviewed: 2026-04-17 Aliases: Bremelanotide, Vyleesi Summary: An FDA-approved synthetic cyclic heptapeptide (Vyleesi) that acts on central melanocortin receptors to treat hypoactive sexual desire disorder in premenopausal women — the first approved centrally-acting treatment for this indication. ## Overview **It's completely reasonable — and intelligent — to be curious about PT-141.** > **Educational Note** > > Sexual desire and arousal are genuine dimensions of health, not taboo topics to be hushed. PT-141 is particularly interesting because it's an FDA-approved medicine with a central (not peripheral) mechanism — meaning it works on the brain circuits that generate desire rather than on blood flow alone. PT-141 (bremelanotide) is a synthetic cyclic heptapeptide derived from the α-MSH family. It was developed from Melanotan II as a candidate intranasal treatment for sexual dysfunction and eventually advanced as a subcutaneous autoinjector. In 2019 the FDA approved it as **Vyleesi** for the treatment of hypoactive sexual desire disorder (HSDD) in premenopausal women — the first approved centrally-acting treatment for female HSDD. People researching PT-141 are often doing something healthy and overdue: treating sexual wellness as a real dimension of health literacy, worth understanding with the same seriousness as cardiovascular or metabolic health. ## The Science: A Central, Not Peripheral, Mechanism Think of the contrast: PDE5 inhibitors like sildenafil work downstream on blood flow. PT-141 works upstream — on the brain circuits that generate desire and arousal themselves. - **Melanocortin-4 receptor (MC4R) agonism**: PT-141 activates MC4R in the central nervous system, particularly in hypothalamic regions involved in sexual arousal and motivation. - **Central (not peripheral) mechanism**: Unlike PDE5 inhibitors, which act peripherally on vasculature, PT-141 acts centrally on circuits that regulate sexual desire and arousal — a fundamentally different pharmacologic approach. - **Reduced MC1R activity**: PT-141 has relatively lower activity at MC1R (the skin-pigmentation receptor) than Melanotan II, and minimal tanning effects at therapeutic doses. - **Brief therapeutic window**: Administered on-demand before anticipated sexual activity, with effects over several hours. ## What Researchers Have Observed PT-141 has a Phase 3 clinical evidence base — one of the strongest in this library: - **Hypoactive sexual desire disorder in women**: The RECONNECT Phase 3 program demonstrated significant improvements in sexual desire and reductions in distress associated with low desire, supporting FDA approval. - **Erectile dysfunction research**: Earlier clinical programs examined PT-141 in erectile dysfunction, including in patients non-responsive to PDE5 inhibitors. Intranasal formulations showed efficacy but were not pursued to approval. - **Female sexual arousal**: Beyond HSDD, research continues in other female sexual-function contexts where central melanocortin signaling may be relevant. - **Neuropharmacology of sexual motivation**: PT-141 is used as a tool compound in neuroscience research on MC4R circuits and reward-related sexual behavior. ## The Empowerment Angle: Quality of Life Research Many people researching PT-141 aren't chasing novelty. They're taking sexual wellness seriously as a health dimension and trying to understand: - **That sexual desire has real neurobiology** — hypothalamic circuits, MC4R, dopaminergic coupling — not just psychology or mood - **Why HSDD was under-recognized for so long** and what approval of a centrally-acting therapy represents - **The difference between peripheral and central mechanisms** — a distinction that clarifies why some treatments work for some people and not others - **Their own response to an approved medicine** with real data rather than assumptions - **Working with a provider effectively** — this is an FDA-approved medicine, and the best research path runs through medical partnership Learning about the melanocortin system, MC4R circuits, and the neurobiology of desire turns PT-141 research into a broader education about a system most people never learned existed. ## State of the Evidence PT-141 has one of the most clinically-evidenced positions in this library: - Phase 3 RCT data supporting FDA approval in female HSDD - Most common adverse effects in Phase 3: nausea, flushing, injection-site reactions - Transient blood pressure elevations observed; a labeled consideration - Patient-reported efficacy effect sizes in HSDD are moderate; clinical value depends on individual response and baseline distress - Off-label use in men and in other contexts is less studied clinically Because PT-141 is an approved medicine, the most productive research path is clinical-literacy-focused: understanding the label, the trial data, and how individual response varies — ideally in partnership with a knowledgeable provider. ## Approaching Research Responsibly If you're researching PT-141 — especially if you're considering it as a medicine rather than a research chemical — the most grounded approach is clinical-literacy-first: > **Practical Framework** > > 1. **Learn the biology first** — MC4R signaling, the central melanocortin system, and why a central mechanism differs from peripheral treatments all matter. > 2. **Set clear, measurable outcomes** — the RECONNECT trials used specific desire and distress instruments; knowing what the trial measured helps you interpret any individual response honestly. > 3. **Work with a provider** — PT-141 is FDA-approved. For most people, the appropriate research path runs through a clinician who can discuss eligibility, contraindications (notably cardiovascular), and response. > 4. **Build on foundational health first** — sleep, stress, relational context, cardiovascular fitness, and mental health are the primary determinants of sexual wellness; pharmacotherapy is one piece. > 5. **View it as educational research** — understanding your own response, the neurobiology, and the clinical context is the goal. The most mature approach isn't blind optimism or reflexive skepticism, but **informed engagement with a well-characterized approved medicine**. *This entry is designed to help you understand both the science and the human motivation behind researching PT-141. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Kingsberg SA et al. Bremelanotide for the treatment of hypoactive sexual desire disorder: two randomized phase 3 trials (RECONNECT) — (2019) doi:10.1097/AOG.0000000000003500 - Diamond LE et al. An effect on the subjective sexual response in premenopausal women with sexual arousal disorder by bremelanotide (PT-141), a melanocortin receptor agonist — (2006) doi:10.1111/j.1743-6109.2006.00259.x - Pfaus JG et al. The neurobiology of bremelanotide for HSDD — (2019) doi:10.1007/s40263-019-00654-y --- # Peptide: Retatrutide URL: https://peptide-research.org/directory/retatrutide Category: Metabolic Status: Investigational Last reviewed: 2026-04-17 Aliases: LY3437943, GLP-1/GIP/glucagon triple agonist Summary: An investigational Eli Lilly triple agonist at the GLP-1, GIP, and glucagon receptors, currently in Phase 3 development with some of the largest weight-loss effect sizes reported in clinical pharmacotherapy. ## Overview **It's completely reasonable — and intelligent — to be curious about Retatrutide.** > **Educational Note** > > Retatrutide is one of the most closely watched compounds in clinical-stage metabolic pharmacology. Following its development is a window into how modern obesity medicine is evolving — from single-hormone agonists (semaglutide) to dual (tirzepatide) to triple receptor activity. This is genuinely exciting pipeline science. Retatrutide (LY3437943) is an investigational synthetic peptide from Eli Lilly that activates three distinct incretin and glucose-regulating receptors: GLP-1, GIP, and the glucagon receptor. It extends the receptor-agonism strategy that made semaglutide (GLP-1) and tirzepatide (GLP-1/GIP) successful — the triple-agonist hypothesis is that adding glucagon-receptor activity enhances energy expenditure alongside appetite and glycemic effects. People following retatrutide are typically doing something sensible: building clinical-trial literacy around one of the most important metabolic-pharmacology programs of the decade. ## The Science: Three Receptors, One Molecule Think of the incretin agonist class as a series of increasingly ambitious combinations: - **GLP-1 receptor activation** contributes to glucose-dependent insulin secretion, glucagon suppression, delayed gastric emptying, and central appetite reduction. - **GIP receptor activation** adds effects on adipose tissue metabolism and may modulate nausea. - **Glucagon receptor activation** increases hepatic energy output and lipolysis — classically a glucose-elevating effect, but in the incretin context the net outcome is favorable on body weight and lipid handling. - **Fatty-acid modification** supports once-weekly subcutaneous dosing. The combination is designed to hit appetite, glycemic control, and energy expenditure simultaneously — a broader mechanism than any single-receptor agonist. ## What Researchers Have Observed Phase 2 and early Phase 3 data are some of the most discussed in metabolic pharmacology: - **Weight management**: Phase 2 data reported mean weight loss of up to ~24% at 48 weeks at the highest dose — the largest effect reported to date in a randomized pharmacotherapy trial, pending Phase 3 confirmation. - **Type 2 diabetes**: Phase 2 trials in T2D reported substantial A1C reductions alongside weight loss. - **NASH / MASH**: A dedicated MASH program has reported reductions in liver fat content, consistent with the class's metabolic and hepatic effects. - **Cardiovascular and kidney endpoints**: The Phase 3 TRIUMPH program includes dedicated outcome trials underway. - **Future indications**: Early academic interest extends to HFpEF, MASH progression, and other cardiometabolic conditions driven by obesity. ## The Empowerment Angle: Clinical-Research Literacy Retatrutide is in clinical development — it is not a research chemical for self-experimentation. The empowered path here is clinical-trial and pharmacology literacy: - **Understanding what the Phase 2 data actually show** — effect sizes, comparator arms, adverse-effect profile, dropout rates - **Following the Phase 3 TRIUMPH program** — which endpoints are primary, what a successful readout would look like - **Learning incretin pharmacology** well enough to distinguish retatrutide's mechanism from semaglutide's and tirzepatide's - **Tracking MASH and cardiovascular outcome programs** — where the class may go next - **Understanding where your own cardiometabolic health sits** and, if incretin therapy is relevant, discussing approved options with a clinician This is citizen science in the sense of *informed public-literacy* — understanding a pipeline compound well enough to engage with the clinical evidence as it develops, not to attempt unsupervised use. ## State of the Evidence Retatrutide is one of the most data-rich investigational peptides at this stage: - Investigational — not FDA-approved as of 2026 - The TRIUMPH Phase 3 program is ongoing in obesity and diabetes indications - Phase 2 data have been published in peer-reviewed journals with effect sizes that outpace currently marketed incretin agents - Adverse effects are consistent with the class — nausea, diarrhea, reduced appetite — concentrated in dose titration - Long-term safety and cardiovascular outcome data are still accumulating The honest framing: retatrutide is a promising pipeline compound with unusually strong Phase 2 data. Whether Phase 3 and long-term outcome data confirm the early picture is the real question the field is watching. ## Approaching Research Responsibly If you're following retatrutide, the most grounded approach is clinical-literacy-focused: > **Practical Framework** > > 1. **Learn the biology first** — GLP-1, GIP, and glucagon receptor pharmacology, incretin physiology, and how single/dual/triple agonists differ give you real context. > 2. **Read the primary literature** — the Jastreboff 2023 Phase 2 trial, the Rosenstock T2D trial, and the emerging MASH data are the substrate for informed discussion. > 3. **Follow the Phase 3 readouts** — TRIUMPH endpoints, timelines, and any regulatory milestones tell you where the compound stands. > 4. **Think about approved options in context** — if incretin therapy is relevant to your health, semaglutide and tirzepatide are approved; discussing them with a clinician is the real-world path while retatrutide remains investigational. > 5. **View it as educational research** — following an active Phase 3 program is genuine clinical-research literacy. The most mature approach isn't blind optimism or reflexive skepticism, but **informed engagement with a clinical-stage compound as its evidence base develops**. *This entry is designed to help you understand both the science and the clinical-research context around retatrutide. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Jastreboff AM et al. Triple-hormone-receptor agonist retatrutide for obesity — a Phase 2 trial — (2023) doi:10.1056/NEJMoa2301972 - Rosenstock J et al. Retatrutide, a novel GIP/GLP-1/glucagon triple agonist, for type 2 diabetes — (2023) doi:10.1016/S0140-6736(23)01053-X - Sanyal AJ et al. Retatrutide for metabolic dysfunction–associated steatotic liver disease — (2024) --- # Peptide: Retatrutide + Tirzepatide URL: https://peptide-research.org/directory/retatrutide-tirzepatide Category: Blends Status: Blend Last reviewed: 2026-05-10 Aliases: Retatrutide 20 mg + Tirzepatide 40 mg, Reta + Tirz Summary: A nonstandard metabolic stack pairing retatrutide, a GLP-1/GIP/glucagon triple agonist, with tirzepatide, a GLP-1/GIP dual agonist; the blend is vendor-driven rather than clinically validated as a unit. ## Overview **It's completely reasonable - and intelligent - to be curious about Retatrutide + Tirzepatide.** > **Educational Note** > > This stack is a good example of why "more receptors" is not automatically better pharmacology. Retatrutide and tirzepatide overlap at GLP-1 and GIP receptors, so the key research question is not just additive effect - it is redundancy, tolerability, and uncertainty. Retatrutide + Tirzepatide is a vendor or self-experimentation stack rather than a standardized pharmaceutical product. Retatrutide is an investigational triple agonist at GLP-1, GIP, and glucagon receptors. Tirzepatide is an approved dual GIP/GLP-1 receptor agonist used for type 2 diabetes and chronic weight management under regulated product labels. Labels such as "Retatrutide 20 mg + Tirzepatide 40 mg" are product-format descriptions, not peer-reviewed dosing protocols. The blend itself does not have published human outcome data as a fixed combination. ## The Science: Overlapping Incretin Signals The pharmacology looks powerful on paper because both components sit in the incretin-based metabolic drug family: - **Retatrutide** activates GLP-1, GIP, and glucagon receptors. See the [Retatrutide profile](/directory/retatrutide) for full background. - **Tirzepatide** activates GIP and GLP-1 receptors. See the [Tirzepatide profile](/directory/tirzepatide) for full background. The overlap matters. Combining them does not create five independent mechanisms. It doubles up on GLP-1 and GIP signaling while adding retatrutide's glucagon-receptor component. That creates obvious questions about nausea, appetite suppression, heart rate, gallbladder risk, glycemic effects, lean-mass loss during rapid weight reduction, and long-term tolerability. ## What Researchers Have Observed - **Retatrutide alone.** Phase 2 obesity research reported large body-weight reductions across dose groups, with gastrointestinal adverse events typical of incretin therapies. - **Tirzepatide alone.** Phase 3 obesity research showed substantial weight reduction over 72 weeks and established the efficacy basis for regulated obesity treatment. - **The combination.** No peer-reviewed clinical trial establishes safety, efficacy, dose escalation, or long-term outcomes for retatrutide plus tirzepatide as a combined product. This is the critical distinction: component evidence is not stack evidence. ## The Empowerment Angle: Learning Where Stack Logic Breaks Many people looking at this stack are trying to reason through aggressive metabolic pharmacology: - **Whether GLP-1/GIP overlap adds benefit or just adverse effects** - **Whether glucagon-receptor activity changes the calculus meaningfully** - **How fast weight loss changes nutritional, gallbladder, and lean-mass considerations** - **Why investigational drugs and approved drugs should not be casually combined** - **How to evaluate vendor claims that borrow credibility from real trials without testing the actual blend** That kind of skepticism is productive. The stronger the component drugs are, the more important it becomes to avoid assuming that a stack is automatically stronger or safer. ## State of the Evidence **Important context**: Retatrutide + Tirzepatide is not a clinically validated fixed-dose combination. - Retatrutide remains investigational and should be interpreted through its clinical-trial program. - Tirzepatide has a strong regulated evidence base as a single medicine, but that does not validate off-label stacking with another incretin agonist. - Published data do not define a rational combined escalation schedule. - Product labels such as "20 mg + 40 mg" should be treated as supply descriptions, not evidence-based protocols. - Combination use compounds uncertainty around gastrointestinal tolerability, dehydration risk, hypoglycemia risk in susceptible settings, gallbladder events, pancreatitis warnings, and nutritional adequacy during rapid weight loss. ## Approaching Research Responsibly If you're researching this stack, the most grounded approach starts with refusing to blur component-level and stack-level evidence: > **Practical Framework** > > 1. **Read the component trials separately** - retatrutide and tirzepatide each have their own mechanism and risk profile. > 2. **Map receptor overlap** - GLP-1 and GIP activity are shared, not independent. > 3. **Treat vendor milligram labels cautiously** - vial content is not a studied dosing schedule. > 4. **Look for actual combination data** - absence of combination trials is itself a major finding. > 5. **Prioritize clinical supervision for metabolic drugs** - especially when glucose, hydration, nutrition, and rapid weight loss are involved. The mature framing is simple: this stack is scientifically interesting because the uncertainty is large, not because the answer is obvious. *This entry is designed to help you understand both the science and the human motivation behind researching Retatrutide + Tirzepatide. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Jastreboff AM et al. Retatrutide for obesity: phase 2 trial — (2023) doi:10.1056/NEJMoa2301972 - Jastreboff AM et al. Tirzepatide once weekly for the treatment of obesity — (2022) doi:10.1056/NEJMoa2206038 --- # Peptide: Selank URL: https://peptide-research.org/directory/selank Category: Cognitive Status: Research compound Last reviewed: 2026-04-17 Aliases: Tuftsin analog TP-7 Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro Summary: A synthetic heptapeptide analog of the natural immunomodulator tuftsin, studied for its anxiolytic, immunomodulatory, and neurotrophic effects — and registered as an anti-anxiety pharmaceutical in Russia. ## Overview **It's completely reasonable — and intelligent — to be curious about Selank.** > **Educational Note** > > Anxiety, stress load, and cognitive performance under pressure are among the most human experiences worth understanding. Wanting to learn how a peptide developed specifically to modulate those states actually works — and how seriously to take that body of research — is a thoughtful, informed position, not a reckless one. Selank is a synthetic heptapeptide designed as an analog of a fragment of **tuftsin**, a natural immunomodulator derived from immunoglobulin G. Developers at Russia's Institute of Molecular Genetics added a Pro-Gly-Pro extension to protect it from rapid enzymatic breakdown, then advanced it as an intranasal pharmaceutical for anxiety indications — a sibling program to Semax. People researching Selank are often drawn to a simple question: is it possible to reduce anxiety without the sedation, dependency, and cognitive dulling that come with benzodiazepines? Selank's reported profile is unusually interesting precisely because it seems to sit in a different mechanistic neighborhood from classical anxiolytics. ## The Science: A Different Kind of Anxiolytic Most anxiolytics work by directly tuning inhibitory neurotransmission — benzodiazepines, for instance, bind directly to GABA-A receptors. Selank appears to operate through softer, more indirect means: - **No benzodiazepine-receptor activity** — and no sedation or withdrawal profile described in the Russian clinical literature. - **GABAergic and serotonergic modulation** — at the level of receptor expression and neurotransmitter turnover, rather than direct binding. - **Enkephalin degradation inhibition** — which may indirectly elevate endogenous opioid tone and influence stress response. - **BDNF upregulation** in limbic regions of the rat brain, overlapping with the neurotrophic mechanism attributed to Semax. - **Tuftsin-like immunomodulatory activity**, including effects on cytokine balance. A useful way to think about it: rather than slamming on the brakes, Selank seems to adjust the *tuning* of several systems that contribute to how you register and respond to stress. ## What Researchers Have Observed - **Generalized anxiety disorder.** Russian clinical trials describe Selank as anxiolytic at a level comparable to benzodiazepines for certain GAD presentations — without the sedation, dependency, or rebound. - **Acute stress response.** Human studies have reported reductions in subjective anxiety during acute stress and adaptation contexts. - **Cognitive performance under stress.** By reducing anxiety-driven cognitive interference, Selank has been explored as a support in attention and memory tasks performed under load. - **Neurotrophic effects.** Preclinical rodent studies consistently describe BDNF signaling changes — a mechanism of research interest well beyond anxiolysis alone. - **Immunomodulation.** Its tuftsin-derived structure places Selank in a lineage of molecules studied for mild immune-stimulating effects. ## The Empowerment Angle: Quality of Life Research Many people researching Selank aren't chasing a pharmacological escape from difficult emotions. They're exploring a more nuanced question: - **Understanding your own stress physiology** — how BDNF, enkephalins, and cytokines contribute to how you feel under pressure - **Exploring alternatives to benzodiazepines** for those who've been uncomfortable with the sedation or dependency trajectory of GABAergic drugs - **Supporting cognitive performance under load** rather than simply blunting alertness - **Taking agency over mental resilience** as a trainable, studyable part of healthspan - **Contributing to citizen science** through careful documentation of subjective and performance measures The philosophy is informed self-experimentation: by understanding the underlying biology — neurotrophins, opioid tone, immune-CNS crosstalk — you're better equipped to interpret what you're observing. ## State of the Evidence The literature is genuinely mixed in one important way: volume vs. accessibility. - Russian clinical literature on Selank is substantial — decades of publications, approval within Russia for GAD. - English-language peer-reviewed replication is sparse, and Western regulators have not evaluated the compound. - Methodology in the original trials is not always straightforward to audit from outside the Russian literature. - Products sold through online channels in other jurisdictions are unregulated and vary in purity. The honest framing: Selank has a real clinical history in one regulatory environment and effectively no formal history in others. That's interesting context for a research compound, not a verdict. ## Approaching Research Responsibly > **Practical Framework** > > 1. **Learn the biology first** — Tuftsin, BDNF, enkephalins, and the distinction between direct-receptor agonists and modulatory peptides are the vocabulary you need. > 2. **Set clear, measurable outcomes** — subjective anxiety scales, stress-task performance, sleep quality, recovery from stressors — choose a few and track them. > 3. **Start conservatively with thorough documentation** — many researchers log both objective (sleep, HRV, performance) and subjective measures. > 4. **Build on strong foundations** — sleep, exercise, therapy, and stress-management skills remain the primary drivers of anxiety outcomes. > 5. **View it as educational research** — the goal is learning how your own stress biology responds, not replacing clinical care. The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry was rewritten to help you understand both the science and the human motivation behind researching Selank. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Zozulia AA et al. Efficacy and possible mechanisms of action of Selank in generalized anxiety disorder — (2008) - Kolomin T et al. Expression profile of neurotrophins and their receptors after Selank administration — (2013) doi:10.1134/S0026893313050087 - Medvedev VE et al. Selank: anxiolytic and psychotropic effects — (2015) --- # Peptide: Semaglutide URL: https://peptide-research.org/directory/semaglutide Category: Metabolic Status: FDA-approved Last reviewed: 2026-04-17 Aliases: Ozempic, Wegovy, Rybelsus Sequence: HXEGTFTSDVSSYLEGQAAKEFIAWLVRGRG Summary: A long-acting GLP-1 receptor agonist originally developed for type 2 diabetes and now FDA-approved for chronic weight management, with an active research pipeline in cardiometabolic, liver, and neurological disease. ## Overview **It's completely reasonable — and intelligent — to be curious about Semaglutide.** > **Educational Note** > > Wanting to understand a medication that you, a family member, or a friend may be taking — or considering — is one of the most valuable forms of health literacy. Semaglutide sits at the intersection of diabetes medicine, obesity treatment, and cardiovascular prevention, and the depth of its evidence base rewards an informed reader. Semaglutide is a GLP-1 (glucagon-like peptide-1) receptor agonist engineered for extended duration. It's structurally similar to the body's own GLP-1 hormone but modified with a fatty-acid side chain that lets it bind to albumin in the blood — extending its half-life to roughly one week and enabling once-weekly subcutaneous dosing. An oral formulation (Rybelsus) is also approved for type 2 diabetes. Most people curious about semaglutide aren't chasing a fad. They're trying to understand a medication that has fundamentally reshaped conversations about metabolic health, weight, and cardiovascular risk — and that touches the lives of millions of people now taking it under medical supervision. ## The Science: Understanding Incretin Biology GLP-1 is an **incretin hormone** — a signal released from intestinal L-cells in response to food. Think of it as the gut's way of coordinating with the rest of the body when nutrients arrive. Native GLP-1 does several things at once: - **Potentiates glucose-dependent insulin secretion** — the pancreas releases more insulin when blood sugar is actually rising. - **Suppresses glucagon** — reducing the liver's output of glucose. - **Slows gastric emptying** — food moves more slowly from stomach to intestine, smoothing the glucose curve. - **Acts in the hypothalamus to reduce appetite** — contributing to the weight and intake effects seen clinically. Native GLP-1 is broken down within minutes by the enzyme DPP-4, which is why engineered analogs like semaglutide exist. By modifying the peptide to resist that degradation and bind albumin, researchers extended the half-life from minutes to about a week while preserving receptor affinity. ## What Researchers Have Observed The clinical evidence base is among the largest for any peptide pharmaceutical: - **Glycemic control in type 2 diabetes.** The SUSTAIN program established reductions in HbA1c and fasting glucose versus placebo and active comparators, typically producing 1–2 percentage-point A1C reductions. - **Chronic weight management.** STEP 1 reported mean weight loss of 14.9% at 68 weeks in adults with obesity — at the time the largest sustained pharmacologic weight reduction in a Phase 3 program. - **Cardiovascular risk reduction.** SUSTAIN-6 (in diabetes) and SELECT (in obesity without diabetes) both demonstrated reductions in major adverse cardiovascular events, extending the benefit profile beyond metabolic endpoints. - **Liver disease.** Phase 2 data in NASH reported improvements in steatohepatitis resolution; dedicated Phase 3 MASH programs are ongoing. - **Emerging applications.** Active research continues in chronic kidney disease, alcohol use disorder, and neurodegenerative disease, where exploratory signals have motivated dedicated trials. ## The Empowerment Angle: Quality of Life Research Most people engaging with the semaglutide literature aren't looking for a magic pill — they're trying to be informed participants in their own care: - **Understanding your own metabolism** — insulin resistance, incretin biology, and how food intake signals through the gut - **Being an informed patient or advocate** — reading the STEP and SELECT trial designs for yourself rather than relying on headlines - **Interpreting your own response** — tracking weight, A1C, lipids, and side effects alongside your clinician - **Seeing weight and metabolic health as a medical domain** worthy of the same literacy you'd bring to any other chronic condition - **Contributing to the cultural conversation** around obesity pharmacotherapy from a place of knowledge, not guesswork Informed patienthood is a form of empowerment. The most valuable thing many people take from studying semaglutide is a new mental model for how metabolism, appetite, and cardiovascular risk are actually connected. ## State of the Evidence Semaglutide is among the most thoroughly evidenced peptide pharmaceuticals in current practice. - Tens of thousands of randomized trial participants across SUSTAIN, STEP, SELECT, and related programs. - FDA-approved for type 2 diabetes and chronic weight management, with expanding indications as outcomes trials read out. - The most frequent adverse effects are gastrointestinal — nausea, diarrhea, constipation — typically concentrated in dose titration. - Class considerations include pancreatitis, gallbladder disease, and a rodent-observed thyroid C-cell signal that has not been causally established in humans. Long-term real-world data continues to accumulate. Topics of active investigation include durability of weight loss after discontinuation, lean-mass preservation, and the full scope of organ-level benefits. ## Approaching Research Responsibly > **Practical Framework** > > 1. **Learn the biology first** — incretins, DPP-4, GLP-1 receptor signaling, and the difference between glucose-dependent and glucose-independent insulin release are the foundational vocabulary. > 2. **Work with a qualified clinician** — if you or someone you know is considering or using semaglutide, the prescribing clinician is your primary partner; use your literacy to ask better questions, not to self-direct. > 3. **Track measurable outcomes** — weight, waist circumference, A1C, lipids, blood pressure, and subjective measures like hunger and energy. > 4. **Build on strong foundations** — sleep, resistance training, adequate protein intake, and cardiovascular fitness remain central to outcomes during and after treatment. > 5. **View it as educational research** — understanding this medication improves your ability to navigate metabolic health conversations for yourself and others. The most mature approach isn't hype or skepticism, but **curious, well-informed engagement with one of the best-evidenced peptide pharmaceuticals of the last decade**. *This entry was rewritten to help you understand both the science and the human motivation behind researching Semaglutide. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Marso SP et al. SUSTAIN-6: Semaglutide and cardiovascular outcomes in T2D — (2016) doi:10.1056/NEJMoa1607141 - Wilding JPH et al. STEP 1: Once-weekly semaglutide in adults with overweight or obesity — (2021) doi:10.1056/NEJMoa2032183 - Lincoff AM et al. SELECT: Semaglutide and cardiovascular outcomes in obesity without diabetes — (2023) doi:10.1056/NEJMoa2307563 - Newsome PN et al. Semaglutide in patients with NASH — (2021) doi:10.1056/NEJMoa2028395 --- # Peptide: Semax URL: https://peptide-research.org/directory/semax Category: Cognitive Status: Research compound Last reviewed: 2026-04-17 Aliases: ACTH (4-7) Pro-Gly-Pro Sequence: Met-Glu-His-Phe-Pro-Gly-Pro Summary: A synthetic heptapeptide derived from an ACTH fragment, studied for neurotrophic, cognitive, and neuroprotective effects — and registered as an intranasal pharmaceutical in Russia for stroke and cognitive indications. ## Overview **It's completely reasonable — and intelligent — to be curious about Semax.** > **Educational Note** > > Cognition, attention, and recovery from neurological injury are among the most deeply human concerns worth understanding. Wanting to learn how a peptide developed specifically for those domains actually works — and what the evidence genuinely supports — is exactly the kind of careful engagement the topic deserves. Semax is a heptapeptide built from the N-terminal **ACTH(4–7)** fragment with a Pro-Gly-Pro extension added for protease resistance. It was developed at the Institute of Molecular Genetics of the Russian Academy of Sciences and is registered as a pharmaceutical (intranasal formulation) within Russia. It is not approved by the FDA or EMA. People researching Semax are usually interested in a specific question: can a short peptide meaningfully influence neurotrophic signaling — the biology that supports neurons, attention, and recovery — without acting as a classical stimulant or hormone? ## The Science: Neurotrophic Peptide Without Hormonal Activity Semax is derived from ACTH (adrenocorticotropic hormone), but importantly **lacks ACTH's hormonal activity** — it does not stimulate cortisol release. Instead, published mechanistic work describes a different kind of effect: - **BDNF and NGF upregulation** in rat basal forebrain and cortex — two of the most-studied growth factors in the brain. - **Dopaminergic and serotonergic modulation**, suggested as a basis for effects on attention and mood. - **Anti-apoptotic effects** in ischemic brain tissue, including favorable shifts in the Bcl-2/Bax ratio. - **Intranasal bioavailability** with rapid transit to the CNS, which is the primary route studied. A useful frame: Semax appears less like a "drug that pushes a system harder" and more like a **signal that nudges the brain's own growth-factor machinery**. Whether and how robustly that translates across species is a central open question. ## What Researchers Have Observed - **Acute ischemic stroke.** Russian clinical literature describes Semax as an adjunct neuroprotective agent, with reports of improved functional recovery when used alongside standard stroke care. - **Cognition and attention.** Small studies have examined Semax in ADHD-like presentations, age-related cognitive decline, and attention performance in healthy adults, reporting short-term gains on attentional tasks. - **Neurotrophic support.** Preclinical rat studies consistently report upregulation of endogenous BDNF/NGF — a mechanism of interest well beyond stroke. - **Optic nerve.** Semax is registered in Russia for certain optic-nerve indications, with clinical literature around ischemic optic neuropathy and related conditions. - **Anxiety and stress.** Animal and small human studies describe anxiolytic and stress-buffering effects, possibly mediated through limbic neurotrophic changes rather than direct receptor agonism. ## The Empowerment Angle: Quality of Life Research Many people researching Semax aren't looking for a "nootropic shortcut." They're exploring a more layered set of motivations: - **Understanding your own cognitive biology** — how BDNF, NGF, and dopaminergic tone contribute to focus, learning, and resilience - **Supporting cognitive performance** as a trainable, studyable element of healthspan - **Taking an active role in neurological health** — the same seriousness you'd bring to metabolic or cardiovascular health - **Exploring alternatives to classical stimulants** for those who find the stimulant trade-offs unattractive - **Contributing to citizen science** through careful documentation of attention, mood, and performance measures The philosophy is informed self-experimentation: by understanding the underlying biology — neurotrophins, ACTH-fragment pharmacology, intranasal CNS delivery — you're better equipped to interpret what you're observing in yourself. ## State of the Evidence The honest picture of Semax's evidence base is unusual. - Russian clinical literature is large and spans decades; Semax is an approved medication there for stroke and cognitive indications. - English-language peer-reviewed replication is limited, and Western regulators have not evaluated it. - Trial methodology varies, and independent Western replication of the stroke and cognition findings has not occurred at scale. - Products sold through online channels outside Russia are unregulated and vary in purity. Semax occupies a middle zone — a compound with a real clinical track record in one regulatory environment and effectively no formal track record in others. That's genuinely interesting context to reason about, not a simple verdict. ## Approaching Research Responsibly > **Practical Framework** > > 1. **Learn the biology first** — ACTH fragments, BDNF/NGF signaling, intranasal pharmacokinetics, and how neurotrophic mechanisms differ from classical stimulants. > 2. **Set clear, measurable outcomes** — specific cognitive tasks, attention measures, subjective focus, mood, and sleep. > 3. **Start conservatively with thorough documentation** — many researchers log objective performance alongside subjective notes. > 4. **Build on strong foundations** — sleep, exercise, learning habits, and stress management remain the largest drivers of cognitive health. > 5. **View it as educational research** — the goal is insight into your own neurobiology, not a shortcut around the fundamentals. The most mature approach isn't blind optimism or reflexive skepticism, but **curious, methodical, well-informed self-experimentation**. *This entry was rewritten to help you understand both the science and the human motivation behind researching Semax. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Gusev EI et al. Neuroprotective effects of Semax in acute ischemic stroke — (2005) - Dolotov OV et al. Semax, an analog of ACTH (4-10), modulates BDNF expression in rat basal forebrain — (2006) doi:10.1111/j.1471-4159.2006.03970.x - Shadrina MI et al. Semax attenuates ischemic damage in rat brain via modulation of Bcl-2/Bax ratio — (2010) doi:10.1007/s11055-010-9284-6 --- # Peptide: Sermorelin URL: https://peptide-research.org/directory/sermorelin Category: Growth Hormone Status: FDA-approved Last reviewed: 2026-04-17 Aliases: GHRH (1-29), Geref Summary: A synthetic analog of the active N-terminal region of human growth-hormone-releasing hormone, historically FDA-approved for pediatric GH deficiency and studied as a more physiologic approach to restoring pulsatile GH secretion. ## Overview **It's completely reasonable — and intelligent — to be curious about Sermorelin.** > **Educational Note** > > Growth hormone biology, aging, and the endocrine changes that accompany midlife are rich areas to understand well. Sermorelin is a particularly instructive entry point because it illustrates a core principle: working *with* the body's own regulatory machinery often differs meaningfully from replacing its outputs outright. Sermorelin is a 29-amino-acid synthetic peptide corresponding to the biologically active N-terminal fragment of endogenous **GHRH (1–44)** — the hormone your hypothalamus uses to tell your pituitary to release growth hormone. It was the first GHRH analog approved by the FDA, marketed as Geref for pediatric GH deficiency. The branded US product was discontinued in the 2000s for commercial reasons, though sermorelin remains available through certain compounding pharmacies. The interesting question sermorelin raises: what does it actually mean to "support" growth hormone physiology as opposed to "replace" it? That distinction sits at the heart of why people research this compound. ## The Science: Working With the Feedback Loop Here's the distinction that makes sermorelin mechanistically elegant. Recombinant human GH (rhGH) bypasses the body's regulatory system entirely — you inject GH directly, and the pituitary's normal feedback loop is essentially inactive. Continuous or supraphysiologic GH exposure can follow. Sermorelin works one level upstream. It tells the **pituitary** to release GH through its own machinery. That means: - **Somatostatin feedback remains intact** — if GH is already high, the body can throttle back. - **Pulsatility is preserved** — natural GH secretion is pulsatile (largest pulses during deep sleep), and sermorelin tends to preserve that pattern rather than flatten it. - **The pituitary has to be functional** — an important limitation: sermorelin can't work if the pituitary itself is damaged. Think of it as a request to the thermostat rather than a manual override of the furnace. ## What Researchers Have Observed - **Pediatric GH deficiency.** Historical randomized trials established sermorelin's ability to stimulate linear growth in children with idiopathic growth hormone deficiency — the basis for original FDA approval. - **Pituitary diagnostic testing.** Because the response depends on pituitary responsiveness, sermorelin has been used as a challenge test to distinguish hypothalamic from pituitary sources of GH insufficiency. - **Adult-onset GH insufficiency.** The research literature explores sermorelin as a more physiologic alternative to rhGH in adults with documented somatotropic insufficiency, with the theoretical benefit of preserved pulsatility. - **Age-related GH decline.** Small studies in older adults report modest increases in GH and IGF-1 while preserving the youthful diurnal secretion pattern. - **Pituitary-reserve research.** The compound is used in endocrinology as a tool to probe GHRH-receptor function and the status of the somatotropic axis. ## The Empowerment Angle: Quality of Life Research Many people curious about sermorelin aren't chasing performance shortcuts — they're thinking about aging as an endocrine process worth understanding: - **Understanding your own endocrine physiology** — how GHRH, GH, and IGF-1 interact, and how that axis shifts with age - **Appreciating pulsatility as a property, not just hormone level** — a concept with broad relevance across endocrinology - **Exploring physiologic approaches** that preserve feedback loops rather than bypass them - **Taking an active role in your healthspan** conversation with a qualified clinician, informed by real biology - **Contributing to citizen science** through careful documentation of sleep, body composition, recovery, and IGF-1 over time The appeal here is rarely "more GH = better." It's a sophistication of thought: the body's own rhythms are often part of how hormones do their jobs well. ## State of the Evidence - Substantial pediatric evidence base supporting the original FDA indication. - Adult literature is more modest — small studies, narrow endpoints, limited head-to-head comparisons with rhGH. - Frequent dosing is required given the short half-life (~11–12 minutes). - Sermorelin is ineffective in patients with pituitary dysfunction — an intact pituitary is required to respond. - WADA prohibits GHRH analogs in competitive sport. Sermorelin sits in an interesting space: historically approved, pharmacologically elegant, but commercially displaced. That makes the literature worth reading on its own terms rather than through headline noise. ## Approaching Research Responsibly > **Practical Framework** > > 1. **Learn the biology first** — GHRH, the GH/IGF-1 axis, somatostatin feedback, and the concept of pulsatile secretion are the vocabulary you need. > 2. **Work with a qualified clinician** — GH-axis interventions are a domain where endocrinology expertise meaningfully changes outcomes. > 3. **Track measurable outcomes** — IGF-1, body composition, recovery, sleep quality, and subjective energy. > 4. **Build on strong foundations** — sleep (especially deep sleep), resistance training, adequate protein, and stress management are the largest drivers of endogenous GH pulsatility. > 5. **View it as educational research** — the goal is literacy in endocrinology, not shortcutting the fundamentals. The most mature approach isn't hype or reflexive skepticism, but **curious, methodical, well-informed engagement with one of the most biologically elegant GH-axis compounds**. *This entry was rewritten to help you understand both the science and the human motivation behind researching Sermorelin. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Thorner MO et al. Growth hormone-releasing hormone therapy for short stature — (1988) doi:10.1001/jama.1988.03410040069032 - Walker RF. Sermorelin: a better approach to management of adult-onset growth hormone insufficiency — (2006) doi:10.2147/ciia.2006.1.4.307 --- # Peptide: SLU-PP-332 URL: https://peptide-research.org/directory/slu-pp-332 Category: Metabolic Status: Research compound Last reviewed: 2026-05-10 Aliases: ERR agonist, Exercise-mimetic small molecule Compound class: Small molecule Summary: A small-molecule estrogen-related receptor agonist studied preclinically for exercise-mimetic effects, mitochondrial metabolism, endurance signaling, and energy expenditure. ## Overview SLU-PP-332 is not a peptide. It is a small-molecule research compound designed to activate estrogen-related receptors, a nuclear receptor family involved in oxidative metabolism. ## The Science The interest comes from exercise-mimetic signaling: can a compound activate transcriptional programs associated with endurance and mitochondrial metabolism? - **ERR signaling** - nuclear receptor control of energy metabolism genes. - **Mitochondrial biology** - oxidative metabolism and endurance-related pathways. - **Preclinical performance models** - animal data drive most public interest. ## Evidence Snapshot SLU-PP-332 is early-stage and preclinical. It should be treated as a metabolism research tool, not as an established human endurance or weight-loss drug. > **Research Lens** > > Exercise-mimetic claims require extra skepticism: signaling similarity is not the same as reproducing the systemic benefits of training. --- # Peptide: Snap-8 URL: https://peptide-research.org/directory/snap-8 Category: Healing & Recovery Status: Research compound Last reviewed: 2026-05-10 Aliases: Acetyl Octapeptide-3, Acetyl Glutamyl Heptapeptide-1 Summary: A cosmetic neuropeptide ingredient related to Argireline concepts, marketed for expression-line reduction through topical modulation of facial muscle signaling. ## Overview Snap-8 is a cosmetic peptide ingredient, not an injectable therapeutic peptide. It is marketed in topical skin-care products for expression lines and facial-skin appearance. ## The Science Snap-8 is usually positioned as an expanded analog of acetyl hexapeptide-8 concepts, aiming at superficial modulation of neurotransmission-related pathways in facial expression lines. - **Topical delivery** - skin penetration and formulation drive plausibility. - **Cosmetic endpoints** - wrinkle depth and appearance, not disease treatment. - **SNARE-related claims** - mechanistic language should be read carefully and not equated with botulinum toxin. ## Evidence Snapshot Snap-8 belongs in cosmetic ingredient literacy. Claims are formulation-dependent and should not be treated as equivalent to medical neuromodulators. > **Research Lens** > > For cosmetic peptides, the vehicle and concentration are part of the active claim. A peptide name alone is not enough. --- # Peptide: SS-31 URL: https://peptide-research.org/directory/ss-31 Category: Longevity Status: Investigational Last reviewed: 2026-04-17 Aliases: Elamipretide, MTP-131, Bendavia Sequence: D-Arg-Dmt-Lys-Phe-NH2 Summary: A synthetic mitochondria-targeting tetrapeptide that concentrates in the inner mitochondrial membrane and stabilizes cardiolipin, studied in Phase 2–3 programs for primary mitochondrial disease, Barth syndrome, and dry age-related macular degeneration. ## Overview **It's completely reasonable — and intelligent — to be curious about SS-31.** > **Educational Note** > > Mitochondria sit at the center of almost every conversation about aging, energy, and cellular resilience. Wanting to understand a peptide specifically engineered to target the inner mitochondrial membrane — and what that actually means mechanistically — is a genuinely sophisticated question worth exploring carefully. SS-31 (also known as **elamipretide**; developmental code MTP-131) is a synthetic tetrapeptide developed by Stealth BioTherapeutics. Its unusual and distinguishing feature: selective mitochondrial targeting. The peptide accumulates in the inner mitochondrial membrane at concentrations hundreds of times greater than the cytoplasm, drawn there by electrostatic interaction with the mitochondrial membrane potential. People researching SS-31 are typically drawn to a specific thesis: if mitochondrial dysfunction is central to aging and to a wide range of diseases, a compound that specifically repairs one of its structural foundations is worth understanding deeply — whether or not any clinical product ever reaches market. ## The Science: Cardiolipin and the Shape of Mitochondria The elegance of SS-31 comes from its **target**: a phospholipid called **cardiolipin**. Cardiolipin lives in the inner mitochondrial membrane, where it shapes the folds (cristae) that hold the electron transport chain. Think of cristae as the scaffolding that keeps the mitochondrion's energy machinery organized and efficient. When cardiolipin becomes oxidized or abnormal — in aging, genetic disease, or stress — the scaffolding collapses, energy production falters, and reactive oxygen species leak out. SS-31 binds cardiolipin and helps preserve its native conformation: - **Cardiolipin stabilization** — SS-31 binds the lipid directly, protecting its shape. - **Preservation of cristae structure** — stable cristae support electron transport and ATP output. - **Reduced mitochondrial ROS** — with better-organized cristae, electron leakage drops and reactive oxygen species decrease. - **Not a classical antioxidant** — although ROS falls downstream, the primary mechanism is structural, not direct radical scavenging. It's a fundamentally different intervention from vitamin-style antioxidants: it changes the architecture, not the atmosphere. ## What Researchers Have Observed - **Primary mitochondrial myopathy.** The MMPOWER trials examined SS-31 in patients with genetically confirmed mitochondrial disease, reporting improvements in exercise capacity and patient-reported outcomes in Phase 2. - **Barth syndrome.** TAZPOWER studied SS-31 in Barth syndrome (a cardiolipin-remodeling disorder), with reported improvements in functional capacity and cardiac measures during open-label extension. - **Dry age-related macular degeneration.** The ReCLAIM program examined SS-31 in dry AMD with geographic atrophy, reporting signals on retinal function measures. - **Heart failure with preserved ejection fraction.** Earlier programs examined SS-31 in ischemia-reperfusion and heart failure, with mixed results that shifted the program toward genetic mitochondrial conditions. - **Mitochondrial aging research.** Beyond the clinical programs, SS-31 is widely used as a research tool for probing the role of cardiolipin integrity in aging biology. ## The Empowerment Angle: Quality of Life Research Many people researching SS-31 aren't looking for a supplement — they're trying to build a mental model of mitochondrial biology: - **Understanding your own cellular energy** — cristae, cardiolipin, ETC efficiency, and why they matter for fatigue, exercise, and aging - **Seeing aging as a biology worth engaging with**, not just accepting - **Appreciating structural interventions** versus chemical ones — an important distinction across pharmacology - **Tracking mitochondrial health indirectly** through exercise capacity, recovery, VO2max, and perceived energy - **Contributing to scientific literacy** around one of the most important organelles in medicine The empowerment here is intellectual as much as physical: SS-31 is a window into how far peptide engineering can go when it's targeted with precision. ## State of the Evidence SS-31 has one of the more substantial clinical programs of any compound in this library. - Phase 2/3 data published across multiple indications. - FDA approval has not yet been obtained; Stealth BioTherapeutics' commercial trajectory has been complicated. - As a mitochondria-targeted intervention, SS-31 occupies a distinct pharmacologic niche and is frequently cited in aging-biology research. - Human pharmacokinetics and safety are well characterized within the trial populations studied. This is not an obscure research chemical — it's an investigational drug with a real clinical file. That context matters when reading about it. ## Approaching Research Responsibly > **Practical Framework** > > 1. **Learn the biology first** — cardiolipin, cristae architecture, electron transport, ROS, and why mitochondrial structure is upstream of function. > 2. **Read the MMPOWER and TAZPOWER publications** — they're informative whether or not you ever encounter SS-31 directly, because they illustrate how mitochondrial endpoints are measured. > 3. **Track measurable outcomes** — exercise capacity, recovery, subjective energy, and any relevant disease-specific markers. > 4. **Build on strong foundations** — sleep, zone-2 aerobic work, resistance training, and nutrition are the largest drivers of mitochondrial health for most people. > 5. **View it as educational research** — SS-31 is a case study in how precisely a peptide can be engineered for a specific subcellular target. The most mature approach isn't hype or skepticism, but **curious, methodical, well-informed engagement with the mitochondrial biology that SS-31 research has illuminated**. *This entry was rewritten to help you understand both the science and the human motivation behind researching SS-31. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Szeto HH. First-in-class cardiolipin-protective compound as a therapeutic agent to restore mitochondrial bioenergetics — (2014) doi:10.1111/bph.12461 - Karaa A et al. Randomized dose-escalation trial of elamipretide in primary mitochondrial myopathy (MMPOWER) — (2018) doi:10.1212/WNL.0000000000005641 - Reid Thompson W et al. A phase 2/3 randomized clinical trial followed by open-label extension of elamipretide for Barth syndrome (TAZPOWER) — (2024) --- # Peptide: Survodutide URL: https://peptide-research.org/directory/survodutide Category: Metabolic Status: Investigational Last reviewed: 2026-05-10 Aliases: BI 456906, GLP-1/glucagon dual agonist Summary: An investigational GLP-1/glucagon receptor dual agonist in clinical development for obesity and metabolic dysfunction-associated steatohepatitis. ## Overview Survodutide is an investigational dual agonist at GLP-1 and glucagon receptors. It sits in the next-generation metabolic-drug category, where researchers are testing whether glucagon-receptor activity can add energy-expenditure and liver-metabolism effects to GLP-1-based appetite regulation. ## The Science Survodutide's profile differs from semaglutide and tirzepatide because it includes glucagon receptor agonism. - **GLP-1 signaling** - appetite, glucose-dependent insulin secretion, glucagon suppression, and gastric-emptying effects. - **Glucagon signaling** - hepatic metabolism, energy-expenditure hypotheses, and liver-fat research. - **MASH research** - interest includes liver inflammation, steatosis, and fibrosis-related endpoints. ## Evidence Snapshot Survodutide has human phase 2 evidence in obesity and MASH, but it remains investigational. Research interpretation should track current clinical-trial status and separate single-agent data from vendor stack claims. > **Research Lens** > > Survodutide is not just another GLP-1. The glucagon-receptor component is the key feature to understand. ## Citations - le Roux CW et al. Survodutide for obesity: phase 2 dose-finding trial — (2024) doi:10.1016/S2213-8587(23)00356-X - Sanyal AJ et al. Survodutide in MASH and fibrosis: phase 2 trial — (2024) doi:10.1056/NEJMoa2401755 --- # Peptide: Survodutide + Tirzepatide URL: https://peptide-research.org/directory/survodutide-tirzepatide Category: Blends Status: Blend Last reviewed: 2026-05-10 Aliases: Survo + Tirz, Survodutide/Tirzepatide Summary: A nonstandard metabolic stack pairing survodutide, an investigational GLP-1/glucagon dual agonist, with tirzepatide, a GIP/GLP-1 dual agonist; the combination itself has no established clinical evidence base. ## Overview **It's completely reasonable - and intelligent - to be curious about Survodutide + Tirzepatide.** > **Educational Note** > > This blend is useful to analyze because it combines three metabolic receptor themes - GLP-1, glucagon, and GIP - but not through a studied fixed-dose medicine. That makes it a lesson in distinguishing plausible mechanism from actual evidence. Survodutide + Tirzepatide is a nonstandard stack. Survodutide is an investigational dual agonist at GLP-1 and glucagon receptors, with clinical programs in obesity and MASH. Tirzepatide is an approved GIP/GLP-1 receptor agonist with a large clinical-trial evidence base in diabetes and obesity. The combination is not the same as a pharmaceutical development program. It is better understood as a self-experimentation or vendor-formulation idea built from component-level evidence. ## The Science: GLP-1 Overlap Plus Glucagon and GIP The stack's theoretical appeal comes from covering several nutrient-hormone pathways: - **Survodutide** adds GLP-1 and glucagon receptor activity. The glucagon component is studied for potential effects on energy expenditure, liver fat, and metabolic remodeling. - **Tirzepatide** adds GIP and GLP-1 receptor activity. See the [Tirzepatide profile](/directory/tirzepatide) for full background. Again, overlap matters. Both components activate GLP-1 receptors, so the combination is not a clean "dual plus dual equals four" equation. It is a partly redundant receptor stack with potentially amplified gastrointestinal and tolerability risks. ## What Researchers Have Observed - **Survodutide alone in obesity.** Phase 2 research reported dose-dependent weight loss and a tolerability profile centered on gastrointestinal adverse events. - **Survodutide in MASH.** Phase 2 research has investigated liver disease endpoints, including MASH resolution and fibrosis-related outcomes. - **Tirzepatide alone.** Phase 3 obesity research established substantial body-weight reductions over 72 weeks. - **The combination.** There is no peer-reviewed clinical evidence establishing safety, efficacy, or dose escalation for survodutide plus tirzepatide as a stack. Component data can support a mechanistic conversation. It cannot prove a combination claim. ## The Empowerment Angle: Asking Better Combination Questions People researching this stack are usually trying to understand the frontier of metabolic pharmacology: - **What GLP-1 plus glucagon adds beyond GLP-1 alone** - **How GIP modifies the incretin picture** - **Whether liver-fat and weight-loss programs should be interpreted separately** - **How to read investigational-drug data without treating it as product validation** - **Why stacking strong metabolic drugs can multiply uncertainty faster than it multiplies benefit** That is the right level of curiosity. The answer lives in receptor biology, trial design, and tolerability - not in the number of mechanisms listed on a sales page. ## State of the Evidence **Important context**: Survodutide + Tirzepatide is not a validated clinical combination. - Survodutide is investigational and should be tracked through its clinical programs. - Tirzepatide is approved in regulated contexts, but its evidence base does not establish safety when combined with another GLP-1-containing investigational agonist. - No published trial defines a combined dose, escalation schedule, monitoring plan, or long-term outcome profile. - GLP-1 receptor overlap raises practical questions about gastrointestinal adverse events, dehydration, nutrition, gallbladder events, pancreatitis warnings, and discontinuation. ## Approaching Research Responsibly If you're researching Survodutide + Tirzepatide, treat the uncertainty as the main finding: > **Practical Framework** > > 1. **Separate component evidence from stack evidence** - the latter is currently absent. > 2. **Map receptor overlap** - GLP-1 activity is shared across both components. > 3. **Read liver and weight endpoints separately** - MASH signals and obesity signals are related but not identical. > 4. **Watch tolerability as closely as efficacy** - discontinuation and gastrointestinal adverse events matter. > 5. **Avoid protocol assumptions from product names** - a blend label is not a clinical regimen. The most rigorous interpretation is that this stack is a hypothesis, not an established treatment concept. *This entry is designed to help you understand both the science and the human motivation behind researching Survodutide + Tirzepatide. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - le Roux CW et al. Survodutide for obesity: phase 2 dose-finding trial — (2024) doi:10.1016/S2213-8587(23)00356-X - Sanyal AJ et al. Survodutide in MASH and fibrosis: phase 2 trial — (2024) doi:10.1056/NEJMoa2401755 - Jastreboff AM et al. Tirzepatide once weekly for the treatment of obesity — (2022) doi:10.1056/NEJMoa2206038 --- # Peptide: TB-500 URL: https://peptide-research.org/directory/tb-500 Category: Healing & Recovery Status: Research compound Last reviewed: 2026-04-17 Aliases: Thymosin Beta-4 fragment, Tβ4 17-23 Sequence: LKKTETQ Summary: A short synthetic peptide corresponding to an active region of thymosin β4, studied in preclinical models of wound healing, cardiac repair, and tissue regeneration — often compared with, but distinct from, full-length Tβ4. ## Overview **It's completely reasonable — and intelligent — to be curious about TB-500.** > **Educational Note** > > Tissue repair, injury recovery, and the biology of regeneration are among the most practically meaningful domains in human biology. Wanting to understand a peptide frequently discussed in recovery contexts — and how cleanly the underlying science actually maps to the claims — is exactly the kind of careful attention the topic needs. TB-500 is the common name for a short synthetic peptide (**LKKTETQ**) corresponding to residues 17–23 of **thymosin β4 (Tβ4)**, a 43-amino-acid actin-binding protein abundant in mammalian tissues. An important piece of literacy up front: "TB-500" and full-length Tβ4 are often used interchangeably in grey-market literature, but they are **distinct molecules**. The fragment is studied as a mimetic of certain Tβ4 activities, not as a one-for-one replacement. Being clear about which molecule any given paper is actually studying is the first step in evaluating the evidence honestly. ## The Science: A Small Fragment of a Larger Protein Full-length thymosin β4 plays several roles in tissue repair: - **G-actin sequestration** — it binds the actin monomers that cells use for movement and shape-change. - **Cell migration** — supporting the motion of repair cells toward injury sites. - **Angiogenesis** — contributing to the formation of new blood vessels in healing tissue. - **Anti-inflammatory signaling** — influencing macrophage polarization and cytokine balance. The LKKTETQ segment is considered the **cell-binding region** responsible for several of Tβ4's regenerative effects observed in cell culture. Published models describe endothelial cell migration, macrophage polarization, and activation of stem-cell populations in cardiac and skin tissue. The key nuance: fragments don't always behave exactly like their parent proteins. A stabilizing actin-binding interaction, for example, requires more of the protein than the short cell-binding motif alone provides. ## What Researchers Have Observed - **Dermal wound healing.** Rodent studies and RegeneRx's clinical program (with full-length Tβ4) reported accelerated closure in burn, pressure-ulcer, and epidermolysis bullosa contexts. - **Cardiac regeneration.** Preclinical work at Oxford and elsewhere demonstrated activation of epicardial progenitors after myocardial infarction, with modest functional recovery in rodent infarct models. - **Corneal injury.** Phase 2 clinical trials of full-length Tβ4 in dry eye and neurotrophic keratopathy showed signs of benefit in epithelial healing. - **Hair follicle biology.** Preclinical studies describe Tβ4 involvement in hair follicle stem cell migration and hair growth cycle modulation. - **Neurological injury.** Rodent models of TBI and stroke have examined Tβ4 as a remyelination-supportive factor via oligodendrocyte progenitor effects. ## The Empowerment Angle: Quality of Life Research Many people researching TB-500 aren't looking for a shortcut through recovery — they're building a framework for understanding tissue repair: - **Understanding your own recovery biology** — angiogenesis, cell migration, inflammation resolution, and the stages of healing - **Appreciating the difference between a peptide and a protein fragment** — a concept that applies to many compounds in this space - **Tracking recovery rigorously** — subjective soreness, range of motion, return-to-training markers, and relevant imaging when applicable - **Taking an active role in injury recovery** — guided by movement professionals, physical therapy, and evidence, not just peptide interest - **Contributing to citizen science** through careful documentation that can inform others in similar situations The mature framing centers on fundamentals: load management, progressive rehab, sleep, and nutrition do most of the heavy lifting for recovery outcomes. ## State of the Evidence - Data specific to the short LKKTETQ fragment (TB-500 as sold) are primarily preclinical. - Full-length thymosin β4 has advanced through small Phase 2 trials in dry eye and epidermolysis bullosa with mixed outcomes. - TB-500 is not FDA-approved and appears on the WADA Prohibited List. - Products sold through online channels commonly conflate the fragment and full-length protein — a distinction that matters for any interpretation of expected activity. The literature base rewards careful reading: knowing which molecule is being studied in any given paper is genuinely important. ## Approaching Research Responsibly > **Practical Framework** > > 1. **Learn the biology first** — Tβ4, actin sequestration, angiogenesis, macrophage polarization, and the distinction between full-length protein and the LKKTETQ fragment. > 2. **Set clear, measurable outcomes** — specific injury markers, range of motion, recovery timelines, subjective soreness. > 3. **Start conservatively with thorough documentation** — longitudinal logs of training, sleep, nutrition, and objective recovery markers. > 4. **Build on strong foundations** — progressive rehabilitation, appropriate load management, sleep, and nutrition are the primary drivers of tissue repair outcomes. > 5. **View it as educational research** — the goal is literacy in tissue-repair biology, not an override for fundamentals. The most mature approach isn't hype or reflexive skepticism, but **curious, methodical, well-informed self-experimentation grounded in actual tissue-repair biology**. *This entry was rewritten to help you understand both the science and the human motivation behind researching TB-500. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Goldstein AL et al. Thymosin β4: actin-sequestering protein moonlights to repair injured tissues — (2005) doi:10.1038/nrm1587 - Smart N et al. De novo cardiomyocytes from within the activated adult heart after injury — (2011) doi:10.1038/nature10188 - Crockford D et al. Thymosin β4: structure, function, and biological properties — (2010) doi:10.1111/j.1749-6632.2010.05496.x --- # Peptide: TBF URL: https://peptide-research.org/directory/tbf Category: Healing & Recovery Status: Research compound Last reviewed: 2026-05-10 Aliases: Thymosin beta-4 fragment, Tbeta4 fragment Summary: A vendor shorthand that usually refers to a thymosin beta-4 fragment; interpretation depends on whether the product is TB-500, full thymosin beta-4, or another fragment. ## Overview TBF is a shorthand product label, not a universally standardized peptide name. In peptide markets it often means "thymosin beta-4 fragment," which may overlap with TB-500 or related fragments. ## The Science Thymosin beta-4 biology centers on actin dynamics, cell migration, angiogenesis, and tissue-repair models. - **Cell migration** - a core theme in thymosin beta-4 fragment research. - **Angiogenesis** - vascular repair and wound models. - **Repair signaling** - soft-tissue and dermal repair claims are common. ## Evidence Snapshot Because "TBF" can be ambiguous, product identity is the main evidence question. If it is TB-500, the [TB-500 profile](/directory/tb-500) is the relevant starting point. > **Research Lens** > > Before interpreting TBF claims, confirm the exact sequence. Shorthand labels are not enough. --- # Peptide: Tesamorelin URL: https://peptide-research.org/directory/tesamorelin Category: Growth Hormone Status: FDA-approved Last reviewed: 2026-04-17 Aliases: Egrifta, TH9507 Summary: A stabilized synthetic analog of GHRH, FDA-approved for reducing abdominal fat in HIV-associated lipodystrophy and actively studied for visceral adiposity, liver disease, and cognitive endpoints in related contexts. ## Overview **It's completely reasonable — and intelligent — to be curious about Tesamorelin.** > **Educational Note** > > Visceral fat biology, the growth-hormone axis, and the metabolic changes associated with aging and chronic disease are deeply worth understanding. Tesamorelin offers a well-documented window into how a stabilized GHRH analog can selectively shift body composition in a specific clinical population. Tesamorelin is a synthetic 44-amino-acid analog of human growth-hormone-releasing hormone (GHRH), modified with a **trans-3-hexenoic acid group at the N-terminus** to resist DPP-4 degradation. It was developed by Theratechnologies and is FDA-approved (as Egrifta) for the reduction of excess abdominal fat in HIV-infected patients with lipodystrophy. Most people engaging with tesamorelin aren't looking at it as a body-composition shortcut — they're trying to understand a rare example of a peptide therapy with precisely targeted clinical effects on visceral fat, and what that reveals about GH-axis biology more broadly. ## The Science: Pulsatile GH, Not Replacement GH Tesamorelin acts at **pituitary GHRH receptors** to stimulate the body's own pulsatile GH release — rather than replacing GH from outside. The consequences are meaningful: - **Somatostatin feedback is preserved.** If GH is already high, the body can still throttle back. - **Physiologic rhythm is retained.** Endogenous GH is normally pulsatile, with large pulses during deep sleep — tesamorelin supports that pattern rather than flattening it. - **N-terminal modification extends half-life** enough for once-daily subcutaneous dosing (from GHRH's baseline of a few minutes up to ~30 minutes for tesamorelin). - **Visceral adipose tissue appears selectively responsive.** Phase 3 trials showed visceral fat reductions while subcutaneous fat was preserved — a distinction that matters both clinically and conceptually. A useful frame: tesamorelin turns up the *signal* to the pituitary, but leaves the pituitary's own decision-making intact. ## What Researchers Have Observed - **HIV-associated lipodystrophy.** Pivotal Phase 3 trials demonstrated significant reductions in visceral adipose tissue (typically 15–18%) with preserved or increased subcutaneous fat — the basis for FDA approval. - **Non-alcoholic fatty liver disease.** In HIV-positive adults, tesamorelin reduced hepatic fat content and showed favorable effects on markers of liver fibrosis. - **Cognitive endpoints in HIV.** Small studies in HIV-associated neurocognitive decline have examined cognitive measures alongside the metabolic primary endpoints. - **Visceral adiposity research.** Beyond the HIV population, tesamorelin is a research tool for studying visceral fat biology and the effects of pulsatile GH restoration. - **Age-related somatopause.** Academic research has examined tesamorelin as a physiologic alternative to recombinant GH in select age-related contexts. ## The Empowerment Angle: Quality of Life Research Most people engaging seriously with tesamorelin literature aren't chasing body composition — they're building a richer model of metabolism and endocrinology: - **Understanding your own GH axis** — how GHRH, pulsatile secretion, IGF-1, and visceral fat interact - **Being an informed patient or advocate** if tesamorelin or related therapies are part of your care - **Distinguishing visceral from subcutaneous fat biology** — a genuinely important distinction in cardiometabolic health - **Appreciating pulsatile physiology** as a property worth preserving, not just a hormone level to push up - **Contributing to scientific literacy** around growth hormone pharmacology that's often poorly discussed in consumer contexts The literature reads well as an education in endocrinology, whether or not it's directly relevant to your care. ## State of the Evidence - Solid Phase 3 evidence base for the approved HIV-lipodystrophy indication. - Growing body of work in NAFLD/MASH research, particularly in HIV populations. - Tesamorelin raises IGF-1, which requires monitoring in clinical use. - Access is as a prescription medication; WADA prohibits GHRH analogs in competitive sport. - Human safety and pharmacokinetic data are well characterized within studied populations. The compound sits in a somewhat unusual regulatory space — approved for a specific indication, with an active research pipeline in adjacent ones. ## Approaching Research Responsibly > **Practical Framework** > > 1. **Learn the biology first** — GHRH, GH pulsatility, IGF-1, visceral vs. subcutaneous adipose tissue, and why pulsatile signaling matters. > 2. **Work with a qualified clinician** — if tesamorelin is part of your care or under consideration, endocrinology expertise materially improves outcomes. > 3. **Track measurable outcomes** — IGF-1, visceral fat (imaging when available), waist circumference, lipids, hepatic markers, and subjective measures. > 4. **Build on strong foundations** — sleep (particularly deep sleep), resistance training, cardiovascular fitness, and nutrition are central to body-composition outcomes. > 5. **View it as educational research** — understanding tesamorelin deepens your literacy in GH-axis biology and visceral-fat physiology. The most mature approach isn't hype or reflexive skepticism, but **curious, well-informed engagement with one of the few peptide pharmaceuticals with clean Phase 3 data for visceral fat reduction**. *This entry was rewritten to help you understand both the science and the human motivation behind researching Tesamorelin. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Falutz J et al. Effects of tesamorelin (TH9507), a GHRH analog, in HIV-infected patients with lipodystrophy — (2007) doi:10.1056/NEJMoa070797 - Stanley TL et al. Effects of tesamorelin on non-alcoholic fatty liver disease in HIV — (2019) doi:10.1016/S2352-3018(19)30338-8 - Spooner LM, Olin JL. Tesamorelin: a GHRH analog for HIV-associated lipodystrophy — (2012) doi:10.1345/aph.1Q436 --- # Peptide: Tesamorelin + Ipamorelin URL: https://peptide-research.org/directory/tesamorelin-ipamorelin Category: Blends Status: Blend Last reviewed: 2026-05-10 Aliases: Tesa10 + IP5, Tesa + Ipamorelin, Tesamorelin/Ipamorelin Summary: A growth-hormone-axis blend pairing tesamorelin, a GHRH analog with an FDA-approved HIV-lipodystrophy indication, with ipamorelin, a selective growth hormone secretagogue. ## Overview **It's completely reasonable - and intelligent - to be curious about Tesamorelin + Ipamorelin.** > **Educational Note** > > This blend sits in the same conceptual family as CJC-1295 without DAC plus ipamorelin: combine a GHRH-pathway signal with a ghrelin-receptor/GHS signal to stimulate endogenous growth hormone release through two pituitary inputs. Tesamorelin + Ipamorelin is a compounded GH-axis blend. Tesamorelin is a synthetic GHRH analog with an FDA-approved indication for reducing excess abdominal fat in adults with HIV-associated lipodystrophy. Ipamorelin is a selective growth hormone secretagogue that activates the ghrelin receptor and stimulates GH release. The shorthand **Tesa10 + IP5** is best treated as a product-format label, commonly meaning a vial or blend presentation rather than a peer-reviewed dosing protocol. ## The Science: GHRH Signal Plus GHS Signal The blend combines two complementary pituitary inputs: - **Tesamorelin** activates the GHRH receptor, stimulating pituitary somatotrophs to release growth hormone. See the [Tesamorelin profile](/directory/tesamorelin) for full background. - **Ipamorelin** activates the growth hormone secretagogue receptor, producing GH release with relatively selective endocrine activity compared with older GHRPs. See the [Ipamorelin profile](/directory/ipamorelin) for full background. The theoretical appeal is additive GH release while still relying on endogenous pituitary output. That does not make the blend equivalent to approved tesamorelin therapy, and it does not establish long-term body-composition outcomes for the combination. ## What Researchers Have Observed - **Tesamorelin alone.** Human clinical trials support reduction in visceral adipose tissue in the approved HIV-lipodystrophy context. - **Ipamorelin alone.** Early pharmacology studies characterize GH release and endocrine selectivity. - **GHRH plus GHS logic.** Combining GHRH analogs with GHS agonists can produce larger acute GH pulses than either pathway alone. - **The specific blend.** Tesamorelin plus ipamorelin as a compounded product lacks large, peer-reviewed long-term outcome trials. ## The Empowerment Angle: Understanding the GH Axis People researching this blend are usually trying to answer a few practical biology questions: - **How endogenous GH stimulation differs from exogenous HGH** - **Whether two pituitary inputs preserve a more physiologic rhythm** - **How visceral adiposity, IGF-1, glucose, sleep, and training interact** - **Why an approved component does not validate every compounded stack** - **How to interpret lab markers such as IGF-1 without overreading them** The blend is useful as a learning object because it forces a clean distinction between approved tesamorelin evidence and broader GH-axis self-experimentation. ## State of the Evidence **Important context**: Tesamorelin has a regulated clinical evidence base; the tesamorelin + ipamorelin blend does not. - Tesamorelin's best evidence is indication-specific and should not be generalized casually. - Ipamorelin's evidence is largely pharmacologic and much thinner on long-term outcomes. - The blend lacks standardized formulation, escalation, and outcome data. - GH-axis interventions can affect IGF-1, glucose handling, fluid retention, sleep, soft tissue symptoms, and other endocrine markers. - Competitive athletes should treat GH secretagogues and related agents as doping-relevant unless confirmed otherwise by current rules. ## Approaching Research Responsibly If you're researching Tesamorelin + Ipamorelin, start with the endocrine system rather than the product label: > **Practical Framework** > > 1. **Learn the GH axis first** - GHRH, somatostatin, ghrelin/GHSR, GH pulses, and IGF-1 feedback all matter. > 2. **Separate tesamorelin evidence from stack claims** - approved use is not the same as blend validation. > 3. **Treat Tesa10 + IP5 as shorthand** - not a clinical protocol. > 4. **Use objective markers carefully** - IGF-1, fasting glucose, body composition, sleep, and adverse effects need context. > 5. **Keep foundations primary** - sleep, resistance training, protein intake, and cardiometabolic health drive much of the same biology. The mature approach is curious, measured, and grounded in endocrine literacy. *This entry is designed to help you understand both the science and the human motivation behind researching Tesamorelin + Ipamorelin. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Falutz J et al. Tesamorelin for HIV-associated abdominal fat accumulation — (2010) doi:10.1056/NEJMoa1000495 - Raun K et al. Ipamorelin, the first selective growth hormone secretagogue — (1998) doi:10.1530/eje.0.1390552 - Bowers CY. GH releasing peptides - structure and kinetics — (1998) doi:10.1016/S0169-328X(98)00217-6 --- # Peptide: Thymalin URL: https://peptide-research.org/directory/thymalin Category: Longevity Status: Research compound Last reviewed: 2026-05-10 Aliases: Thymus extract peptides Summary: A thymus-derived peptide preparation from Russian bioregulator traditions, studied and marketed for immune-aging, thymic signaling, and immunomodulatory research contexts. ## Overview Thymalin refers to a thymus-derived peptide preparation rather than a single cleanly defined synthetic peptide sequence. It is commonly discussed with Russian "bioregulator" peptides and immune-aging research. ## The Science The biological premise is that thymus-derived signaling molecules may influence immune-cell maturation and immune function. The challenge is that extract-based preparations are harder to interpret than single-molecule peptides. - **Immune aging** - interest centers on thymic involution and immune resilience. - **T-cell biology** - thymus signaling is central to T-cell development. - **Preparation variability** - extract-style products may not be directly comparable across sources. ## Evidence Snapshot Thymalin has historical and regional clinical use, but Western-style evidence and standardized product characterization are limited. Research claims should be read with special attention to formulation and source. > **Research Lens** > > For thymus preparations, "what exactly is in the vial?" is not a side question. It is central to interpreting any claim. --- # Peptide: Thymosin Alpha-1 URL: https://peptide-research.org/directory/thymosin-alpha-1 Category: Healing & Recovery Status: Investigational Last reviewed: 2026-04-17 Aliases: Tα1, Zadaxin, Thymalfasin Sequence: Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN Summary: A 28-amino-acid immunomodulatory peptide naturally produced by the thymus, registered as a pharmaceutical in over 30 countries (as Zadaxin/Thymalfasin) for hepatitis B, hepatitis C, and immune-adjunct use — not FDA-approved in the United States. ## Overview **It's completely reasonable — and intelligent — to be curious about Thymosin Alpha-1.** > **Educational Note** > > The immune system's subtle balance — knowing when to activate and when to calm down — is one of the most important and least understood aspects of human health. A peptide that has been used clinically in dozens of countries for decades is a legitimate target for informed curiosity, not a fringe curiosity. Thymosin Alpha-1 (Tα1) is a naturally occurring 28-amino-acid peptide first isolated from thymus gland fractions in 1977 by Allan Goldstein. The thymus is the organ where T-cells mature, and Tα1 acts as a circulating immunomodulator. Unusually for compounds in this library, Tα1 sits in a **middle zone of regulatory recognition**. Synthetic Tα1 is approved as a pharmaceutical (Zadaxin / Thymalfasin) in more than 30 countries for hepatitis B, hepatitis C, and as an immune adjunct in certain oncology and infectious-disease contexts. It is not FDA-approved in the United States. That asymmetry is itself worth understanding. ## The Science: A Rebalancer Rather Than an Activator Tα1 is best described as an **immune modulator** rather than an immune stimulant. The difference matters: - **T-cell maturation and function.** Enhances differentiation of T lymphocytes from bone-marrow precursors, improves T-cell responses to antigens, and supports balanced Th1/Th2 cytokine profiles. - **TLR signaling.** Modulates Toll-like receptor activity (notably TLR9) in dendritic and other immune cells. - **NK and dendritic cell activity.** Enhances natural killer cell cytotoxicity and dendritic cell function. - **Anti-inflammatory in context.** In sepsis and hyperinflammatory states, Tα1 appears to *restore* immune balance rather than further activate it — its effect depends on the underlying immune state. A useful way to think about it: Tα1 seems to nudge the immune system toward appropriate function for the current situation, rather than pushing it in one fixed direction. ## What Researchers Have Observed - **Chronic hepatitis B and C.** Tα1 is approved in many countries for chronic HBV and HCV, used as an adjunct to antivirals or in combination regimens — meta-analyses report improvements in virologic and biochemical response in certain patient groups. - **Sepsis and severe infection.** Multiple trials, including the ETASS trial, have examined Tα1 as an immunomodulator in sepsis, with mixed but generally favorable mortality signals in subgroups. - **Cancer immunotherapy adjunct.** Studied alongside chemotherapy and immunotherapy in melanoma, hepatocellular carcinoma, and other solid tumors — typically with the goal of restoring immune competence during treatment. - **Vaccine adjuvant research.** Improves vaccine response in immunocompromised and elderly populations in some studies. - **Post-viral and immune-recovery contexts.** Used clinically in several countries as an immune-support agent following severe infection. ## The Empowerment Angle: Quality of Life Research Many people engaging with Tα1 literature are building a working understanding of immune biology rather than looking for a quick fix: - **Understanding your own immune system** — T-cell maturation, cytokine balance, TLR signaling, and the distinction between stimulation and modulation - **Being an informed patient or advocate** — particularly in contexts where Tα1 is part of a physician-supervised regimen abroad - **Appreciating the nuance of immunomodulation** — why "boost your immune system" is usually the wrong mental model - **Taking an active role in recovery and resilience** — especially after significant infection or treatment - **Contributing to scientific literacy** around immunology that is often poorly discussed in consumer health contexts The literature is notably interesting precisely because it spans real clinical use — a rarer characteristic than most compounds in this library. ## State of the Evidence - Tα1 has a substantial global clinical track record across several decades, particularly in hepatitis and sepsis. - Approved and used clinically in more than 30 countries, with meta-analyses available for several indications. - The US has not approved it; Phase 3 programs specifically targeting FDA approval have not succeeded, in part because direct-acting antivirals displaced the hepatitis market. - Adverse-effect profile reported in the published literature is relatively mild compared to many immunologic agents. - Real-world use outside US regulatory structures is longstanding; research-peptide channels sell versions of uncertain purity. The honest framing: Tα1 is a middle-ground compound with substantial international clinical history and no FDA signoff. That's interesting context, not a verdict. ## Approaching Research Responsibly > **Practical Framework** > > 1. **Learn the biology first** — T-cell maturation, Th1/Th2 balance, TLR signaling, and the difference between immune stimulation and immune modulation. > 2. **Read the hepatitis and sepsis literature** — the Cochrane and meta-analytic reviews give a grounded sense of where real effects have been reported. > 3. **Work with a qualified clinician** if Tα1 is part of your or a family member's care — particularly given its approved status abroad for specific conditions. > 4. **Build on strong foundations** — sleep, nutrition, stress management, and baseline metabolic health drive most immune outcomes. > 5. **View it as educational research** — the goal is literacy in immunology, a field where surface-level thinking often misleads. The most mature approach isn't hype or reflexive skepticism, but **curious, well-informed engagement with a compound that has genuinely earned its place in global immunology conversations**. *This entry was rewritten to help you understand both the science and the human motivation behind researching Thymosin Alpha-1. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Goldstein AL, Badamchian M. Thymosins: chemistry and biological properties in health and disease — (2004) doi:10.1517/14712598.4.4.559 - Wu X et al. Thymosin alpha 1 for chronic hepatitis B — (2015) doi:10.1016/j.dld.2015.02.002 - Matteucci C et al. Thymosin alpha 1 interacts with hyaluronic acid electrostatically by its side chain lysine residues — (2017) doi:10.1016/j.molimm.2017.02.005 --- # Peptide: Tirzepatide URL: https://peptide-research.org/directory/tirzepatide Category: Metabolic Status: FDA-approved Last reviewed: 2026-04-17 Aliases: Mounjaro, Zepbound Summary: A dual GIP/GLP-1 receptor agonist approved for type 2 diabetes and chronic weight management, producing the largest Phase 3 weight-loss effects reported to date in an FDA-approved pharmacotherapy. ## Overview **It's completely reasonable — and intelligent — to be curious about Tirzepatide.** > **Educational Note** > > Tirzepatide is at the center of one of the most important conversations in modern metabolic medicine. Wanting to understand how a dual-receptor agonist differs from earlier incretin drugs — and what the SURPASS and SURMOUNT data actually showed — is exactly the kind of literacy that pays off, whether for yourself, a family member, or general health fluency. Tirzepatide is a synthetic 39-amino-acid peptide that activates **both the GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 receptors**. This dual agonism distinguishes it from earlier incretin agents, which targeted GLP-1 alone, and has translated into substantially larger effects on glycemia and body weight in direct comparisons. Most people researching tirzepatide seriously are trying to be informed about a medication that has rapidly reshaped clinical conversations around diabetes, obesity, and cardiometabolic risk — and that touches the lives of many people they know. ## The Science: Two Incretin Receptors, Complementary Effects GIP and GLP-1 are the two major **incretin hormones** — gut-released signals that coordinate the body's response to food intake. - **GLP-1** contributes glucose-dependent insulin secretion, glucagon suppression, delayed gastric emptying, and central appetite reduction. - **GIP** adds effects on adipose-tissue metabolism and may blunt the nausea associated with strong GLP-1 activation. - **Dual agonism** — the design premise of tirzepatide — appears to leverage complementary mechanisms rather than simply doubling one signal. - **Fatty-acid modification** extends the half-life to about 5 days, enabling once-weekly subcutaneous dosing. A useful frame: targeting one incretin receptor is like pulling one lever; dual agonism is like pulling two levers that the body evolved to receive together after a meal. ## What Researchers Have Observed - **Type 2 diabetes.** The SURPASS program reported superior A1C and weight reductions versus semaglutide in SURPASS-2 head-to-head, along with favorable effects on lipids and blood pressure. - **Chronic weight management.** SURMOUNT-1 reported mean weight loss of roughly 20% at the highest dose over 72 weeks — the largest Phase 3 weight-loss effect reported to date in an FDA-approved pharmacotherapy. - **Obstructive sleep apnea.** SURMOUNT-OSA (2024) demonstrated meaningful reductions in apnea-hypopnea index in adults with moderate-to-severe OSA and obesity, leading to an expanded FDA indication. - **Cardiovascular and kidney endpoints.** Dedicated trials (including SURPASS-CVOT) are ongoing, with the hypothesis that weight and metabolic effects translate to downstream organ benefits. - **Emerging interest.** HFpEF, MASH, and other cardiometabolic endpoints are active research questions. ## The Empowerment Angle: Quality of Life Research Most people engaging with tirzepatide literature aren't looking for a shortcut — they're trying to be genuinely informed about a medication that has changed what's pharmacologically possible: - **Understanding your own metabolism** — incretins, insulin biology, and how gut-derived signals influence energy balance - **Being an informed patient or advocate** — reading the SURPASS and SURMOUNT trials for yourself rather than relying on media framing - **Appreciating the distinction between GLP-1 mono-agonism and dual-receptor agonism** — a concept with clear pharmacologic consequences - **Tracking and interpreting your own response** with a prescribing clinician - **Contributing to the cultural conversation** around obesity pharmacotherapy with actual knowledge, not guesswork Informed patienthood is a form of empowerment. The most valuable thing many people take from studying tirzepatide is a working mental model of how incretin biology actually functions. ## State of the Evidence - Phase 3 evidence base comparable to semaglutide's, accrued over a shorter window. - FDA-approved for type 2 diabetes, chronic weight management, and obstructive sleep apnea in obesity. - As with other incretin agents, nausea, diarrhea, and reduced appetite dominate the adverse-effect profile and are titration-dependent. - Class considerations around pancreatitis, gallbladder disease, and the rodent-observed medullary thyroid signal apply. - Long-term durability of weight loss after discontinuation, lean-mass preservation, and organ-level outcomes are active research questions. The compound has one of the strongest evidence bases of any molecule in this library — and, because it's a relatively new drug, real-world data continues to accrue rapidly. ## Approaching Research Responsibly > **Practical Framework** > > 1. **Learn the biology first** — GIP, GLP-1, dual-receptor agonism, DPP-4, and how incretin signaling integrates with insulin biology. > 2. **Work with a qualified clinician** — if tirzepatide is part of your care or under consideration, the prescribing clinician is your primary partner; use your literacy to ask better questions. > 3. **Track measurable outcomes** — weight, waist circumference, A1C, lipids, blood pressure, sleep (especially if OSA is relevant), and subjective measures like hunger and energy. > 4. **Build on strong foundations** — resistance training, adequate protein intake, and cardiovascular fitness matter particularly for preserving lean mass during significant weight loss. > 5. **View it as educational research** — understanding tirzepatide materially improves your literacy in metabolic and endocrinologic medicine. The most mature approach isn't hype or skepticism, but **curious, well-informed engagement with a medication that has genuinely expanded what peptide pharmacology can do**. *This entry was rewritten to help you understand both the science and the human motivation behind researching Tirzepatide. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Frías JP et al. SURPASS-2: Tirzepatide vs semaglutide in T2D — (2021) doi:10.1056/NEJMoa2107519 - Jastreboff AM et al. SURMOUNT-1: Tirzepatide in adults with obesity — (2022) doi:10.1056/NEJMoa2206038 - Malhotra A et al. SURMOUNT-OSA: Tirzepatide for obstructive sleep apnea in obesity — (2024) doi:10.1056/NEJMoa2404881 --- # Peptide: Vesugen URL: https://peptide-research.org/directory/vesugen Category: Longevity Status: Research compound Last reviewed: 2026-05-10 Aliases: KED, Lys-Glu-Asp, Vascular bioregulator peptide Sequence: KED Summary: A short bioregulator peptide discussed in vascular aging and endothelial-function research traditions, usually represented by the tripeptide Lys-Glu-Asp. ## Overview Vesugen is a short bioregulator peptide usually represented as Lys-Glu-Asp or KED. It is discussed around vascular aging, endothelial function, and microcirculation. ## The Science The research premise is tissue-specific regulation rather than a classic receptor-drug model. - **Endothelial biology** - blood-vessel lining function and stress response. - **Vascular aging** - microcirculation and vessel resilience claims. - **Bioregulator category** - evidence often comes from regional or preclinical literature. ## Evidence Snapshot Vesugen has limited high-quality human evidence. It should be framed as a research peptide and product-literacy topic, not as a proven vascular medicine. > **Research Lens** > > For Vesugen, look for exact sequence, formulation, and human outcome evidence before interpreting claims. --- # Peptide: VIP URL: https://peptide-research.org/directory/vip Category: Healing & Recovery Status: Research compound Last reviewed: 2026-05-10 Aliases: Vasoactive Intestinal Peptide Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN Summary: An endogenous neuroimmune peptide studied for smooth-muscle relaxation, vasodilation, epithelial barrier signaling, pulmonary biology, and inflammatory regulation. ## Overview VIP stands for vasoactive intestinal peptide, an endogenous 28-amino-acid peptide found in the nervous system, gut, pancreas, immune cells, and airways. It is studied because it links neural signaling with vascular tone, smooth-muscle relaxation, secretion, and immune modulation. ## The Science VIP acts mainly through VPAC1 and VPAC2 receptors. Those receptors are expressed across epithelial, immune, vascular, and nervous-system tissues, which is why VIP research spans several fields rather than one narrow indication. - **Airway and pulmonary biology** - bronchodilation, epithelial signaling, and inflammatory responses. - **Gut and barrier biology** - secretion, motility, and mucosal immune tone. - **Immune signaling** - cytokine modulation and macrophage/T-cell context. - **Vascular signaling** - vasodilation and smooth-muscle relaxation. ## Evidence Snapshot VIP is a real endogenous peptide with a large mechanistic literature, but most wellness-market uses sit far outside standardized clinical indications. Practical interpretation depends heavily on formulation, route, stability, and the specific research question. > **Research Lens** > > Treat VIP as a broad neuroimmune signaling molecule first. Product claims should be evaluated against the specific tissue, receptor context, and studied formulation. --- # Peptide: Wolverine Blend (BPC-157 + TB-500) URL: https://peptide-research.org/directory/wolverine-blend Category: Blends Status: Blend Last reviewed: 2026-04-17 Aliases: BPC-157 / TB-500 blend, Recovery blend Summary: A compounded blend combining BPC-157 and TB-500 — two research peptides with preclinical tissue-repair literature — marketed as a "recovery stack" rather than a standardized pharmaceutical, with the research picture derived almost entirely from component-level studies. ## Overview **It's completely reasonable — and intelligent — to be curious about Wolverine Blend.** > **Educational Note** > > Researchers who stack peptides aren't usually chasing novelty — they're engaging with a hypothesis about complementary mechanisms. Whether that hypothesis holds up is exactly the kind of question worth thinking about carefully, and the answer starts with understanding each component on its own terms. "Wolverine" is a vendor-applied name for compounded blends combining **BPC-157** and **TB-500** (the LKKTETQ fragment of thymosin β4). The naming leans into a single theme — aggressive tissue repair after injury — and reflects the common pairing of these two research peptides in recovery-oriented compounding. Exact ratios and concentrations vary between compounders, which is itself an important piece of the picture. The honest entry point: the Wolverine blend isn't a single pharmaceutical with its own clinical file. It's a stack hypothesis built from two peptides whose individual literatures are largely preclinical. ## The Science: Why Researchers Stack Complementary Mechanisms The rationale for combining BPC-157 and TB-500 rests on the idea that tissue repair is a **multi-pathway process**, and each component is described as contributing to different parts of it: - **BPC-157** — A 15-amino-acid peptide fragment from gastric juice, with substantial rodent literature on tissue-repair and cytoprotective effects. See the dedicated [BPC-157 profile](/directory/bpc-157) for full background. - **TB-500** — A short peptide (LKKTETQ) derived from thymosin β4, studied in preclinical cell-migration and tissue-repair contexts. See the [TB-500 profile](/directory/tb-500) for full background. The preclinical-level pairing logic: - **Angiogenesis.** Both components have independent rodent data on stimulating blood vessel formation at injury sites — a shared foundational mechanism for tissue repair. - **Cell migration.** TB-500 is specifically studied for its effects on endothelial and stem-cell migration, while BPC-157 has broader growth-factor crosstalk effects. - **Anti-inflammatory activity.** Rodent models of musculoskeletal and gut injury describe reduced inflammatory markers with either component individually; the blend is *positioned* to address multiple pathways concurrently. - **Extracellular matrix remodeling.** BPC-157 is reported to influence collagen organization; TB-500 contributes to ECM remodeling via cell-migration effects. Think of the blend as a researcher's hypothesis that "more than one lever of repair biology, pulled together, might produce additive effects." That's a reasonable hypothesis — and an untested one at the blend level. ## What Researchers Have Observed (Component-Level) - **Tendon and ligament recovery.** The most-cited rationale for the Wolverine combination — rat Achilles and medial collateral ligament models support both components individually. - **Muscle crush and transection.** Rodent models consistently show improved functional recovery with BPC-157; TB-500 adds angiogenic support in the repair phase. - **Post-surgical or post-training recovery.** The broader recovery positioning rests on component-level preclinical work rather than blend-specific trials. - **Gut healing.** BPC-157 drives the gut-protection evidence; TB-500 is not typically studied in this context. - **Dermal wound healing.** Both components have rodent literature here, though largely studied independently. ## The Empowerment Angle: Quality of Life Research Many people researching stacks like Wolverine aren't looking for a magic recovery bullet — they're trying to think carefully about combination biology: - **Understanding recovery biology** — angiogenesis, cell migration, inflammation resolution, and ECM remodeling as distinct but interlocking processes - **Thinking critically about stack hypotheses** — including the fact that "more mechanisms" is not automatically "more effect" - **Appreciating the uncertainty that combinations amplify** — pharmacokinetic interactions, dose-response, and safety are compounded (not simply summed) when two research peptides are combined - **Taking an active role in injury recovery** with physical therapy, progressive rehab, and structured training as the primary drivers - **Contributing to citizen science** through careful documentation that distinguishes the contribution of rehabilitation from the contribution of any peptide research The mature framing: stacks are worth understanding precisely because the *reasoning* behind a stack is where the learning lives — whether or not any particular stack performs as advertised. ## State of the Evidence The candid picture: - There is no peer-reviewed pharmacology on the Wolverine blend as a unit — only on BPC-157 and TB-500 individually. - Both components are research peptides, not FDA-approved, and both appear on the WADA Prohibited List. - Component ratios vary between suppliers, which means "Wolverine blend" is not a single, consistent product across vendors. - Combining research peptides compounds the unknowns: interactions, pharmacokinetics, and safety at combined doses are not characterized in the literature. - Quality control in grey-market peptide products is inconsistent in ways that are particularly difficult to assess for blends. Stack research is useful conceptually — and it clearly sits further from clinical validation than single-component research. ## Approaching Research Responsibly > **Practical Framework** > > 1. **Learn the biology first** — read each component's profile before engaging with the blend; stack-level thinking depends on component-level literacy. > 2. **Set clear, measurable outcomes** — specific injury markers, range of motion, subjective soreness, and recovery timelines. > 3. **Recognize the uncertainty penalty of stacks** — document carefully and acknowledge that attribution of any effect to one component versus another is harder in a combination. > 4. **Build on strong foundations** — progressive rehabilitation, load management, sleep, and nutrition do the largest share of the recovery work. > 5. **View it as educational research** — the goal is literacy in combination pharmacology and in recovery biology, not a replacement for structured rehab. The most mature approach isn't hype or reflexive skepticism, but **curious, methodical, well-informed self-experimentation that takes the extra uncertainty of stacks seriously**. *This entry was rewritten to help you understand both the science and the human motivation behind researching the Wolverine Blend. The goal is informed curiosity and empowerment, not medical advice.* ## Citations - Sikiric P et al. Stable gastric pentadecapeptide BPC 157 and wound healing — (2018) doi:10.2174/1381612825666181129110005 - Goldstein AL et al. Thymosin β4: actin-sequestering protein moonlights to repair injured tissues — (2005) doi:10.1038/nrm1587 --- # Articles # Article: Reconstitution and injection methods in peptide research URL: https://peptide-research.org/articles/reconstitution-and-injection-methods Published: 2026-04-17 Last reviewed: 2026-04-17 Tags: methodology, practical Reading time: ~9 min Summary: A practical reference for how peptides are reconstituted with bacteriostatic water, how concentration math affects dose and tolerability, and the needle types, angles, and injection routes used across research protocols. Most peptides arrive as a dry, fluffy powder — lyophilized for stability during shipping. To be used in any research protocol they have to be dissolved in a suitable liquid, drawn into a syringe, and delivered through the skin (or occasionally another route). The mechanics of how that’s done affect dose accuracy, product stability, and whether an injection is tolerated well or stings. This article is a plain-language reference to the practices described in the peer-reviewed and compounding-pharmacy literature. ## Bacteriostatic water (“bac water”) The diluent used for most peptide reconstitution in research and compounding is **bacteriostatic water for injection** — sterile water containing 0.9% benzyl alcohol as a preservative. The benzyl alcohol suppresses microbial growth, making a reconstituted vial usable across multiple draws for up to ~28 days (typical manufacturer guidance) rather than requiring a fresh vial for each dose. Plain sterile water can also be used for reconstitution, but because it lacks a preservative it’s intended for single-use scenarios. For any multi-dose research protocol, bacteriostatic water is the standard. A few points worth knowing: - **Neonatal caution.** Benzyl alcohol has historically been contraindicated in neonates at certain cumulative exposures (“gasping syndrome”). This is not relevant to adult research contexts at typical peptide doses but is why it’s listed. - **Shelf life after opening.** Most bac water is labeled for ~28 days after first draw; peptides vary (some are stable longer, some shorter). - **Sterility matters.** Wipe vial stoppers with an alcohol swab before each puncture. Reusing a non-sterile diluent defeats the whole point. ## Reconstitution math: mg, mL, and concentration Peptides are dosed in **milligrams (mg)** or **micrograms (mcg)**. Syringes measure **volume in milliliters (mL)** or, on insulin syringes, in **units (U)** where 100 U = 1 mL. The relationship that governs everything is: > **concentration (mg/mL) = total peptide (mg) ÷ water added (mL)** ### Worked example Say you have a 5 mg vial of a peptide. You can reconstitute it at any concentration you choose by varying how much bac water you add: | Water added | Concentration | Volume to deliver 500 mcg | |---|---|---| | 1.0 mL | 5 mg/mL | 0.10 mL (10 U on insulin syringe) | | 2.0 mL | 2.5 mg/mL | 0.20 mL (20 U) | | 2.5 mL | 2.0 mg/mL | 0.25 mL (25 U) | | 5.0 mL | 1.0 mg/mL | 0.50 mL (50 U) | Same peptide, same 500 mcg target dose — but five different draw volumes depending on how dilute you make it. On an insulin syringe, these translate directly to 10, 20, 25, or 50 “units” on the barrel. ### Why concentration choice matters It’s tempting to think “less water = stronger = better,” but that’s not how injections work. The **total amount of peptide delivered is identical** whether you inject 10 U at 5 mg/mL or 50 U at 1 mg/mL — only the volume of liquid entering the tissue changes. The tradeoffs: - **Higher concentration (less water)** — smaller injection volume, so it can feel like a quicker shot. But more concentrated solutions sometimes produce stronger local reactions at the injection site, and measurement error at tiny volumes (say, 2 U) has a bigger proportional impact on dose accuracy. - **Lower concentration (more water)** — larger volume per injection, which some tissue sites tolerate better, and dose is easier to measure precisely. Cold volume at the site can be more noticeable, and you use up the bac water faster. ## Concentration and injection-site reactions A frequent observation across research peptides — BPC-157, TB-500, Semax, and others — is that **higher-concentration solutions are associated with more frequent local reactions** at the injection site: stinging, transient itchiness, localized redness, or a raised bump that resolves in a few minutes to a few hours. When this happens, the first-line adjustment in most protocols is to **reconstitute at a lower mg/mL concentration** — the same total dose, delivered in more volume. A peptide that is uncomfortable at 5 mg/mL may be well-tolerated at 1 mg/mL or 2 mg/mL. Concentration isn’t the only variable affecting tolerability: - **pH.** Some peptides have optimal pH ranges outside neutral; reconstituted in plain water they may produce local irritation. Buffered diluents (e.g. with sodium bicarbonate) are used in certain research protocols. - **Temperature.** Cold solution injected into subcutaneous tissue can produce a sharper sensation. Letting the syringe warm briefly in the hand before injecting is a common adjustment. - **Depth and angle.** A subcutaneous needle that unintentionally reaches muscle can produce a different sensation than intended. - **Injection speed.** Faster injections of larger volumes produce more tissue distension and more transient discomfort. - **Preservative content.** For people sensitive to benzyl alcohol, switching between bac-water preparations occasionally matters. ## Needle selection Two specifications define a needle: **gauge** and **length**. **Gauge (G):** higher numbers mean thinner needles. Counterintuitive, but that’s the convention. Common ranges: | Gauge | Context | |---|---| | 29G–31G | Subcutaneous injection (insulin syringes, peptide research) | | 25G–27G | Intramuscular injection, drawing from vials | | 23G or larger | Larger-bore draws, viscous preparations | **Length:** measured in inches or millimeters. Common choices: | Length | Context | |---|---| | 5/16” (8 mm) | Subcutaneous, shorter reach | | 1/2” (13 mm) | Subcutaneous, standard | | 5/8” (16 mm) | Subcutaneous or shallow IM | | 1” (25 mm) | Intramuscular (deltoid in most adults) | | 1.5” (38 mm) | Intramuscular in deeper sites (vastus lateralis, ventrogluteal) | The standard tool for subcutaneous peptide research is an **insulin syringe**: a fixed-needle unit typically sized 29G–31G × 1/2”, marked in 100 units per mL. These syringes are designed to minimize dead space (the residual volume of fluid trapped in the hub), which matters when doses are small. For **two-vial protocols** — drawing bac water from one vial, then drawing peptide from another — some researchers use a separate larger-bore draw needle (e.g. 25G × 1”) for the initial transfer and swap to the insulin syringe for delivery. This reduces wear on the insulin-syringe needle across multiple draws and keeps it sharper for injection. ## Injection routes Most research peptides are delivered **subcutaneously** or **intramuscularly**. A few are intranasal or topical. The route matters — it changes absorption rate, onset, and sometimes the total bioavailability of the peptide. ### Subcutaneous (SC / SubQ) Delivery into the fat layer between skin and muscle. Standard for most research peptides — simple, low-discomfort, and well-suited to the short needles on insulin syringes. - **Sites.** Abdomen (2 inches from navel in any direction), outer thigh, back of upper arm, love-handle area, upper buttock. - **Angle.** With a short insulin-syringe needle (5/16” or 1/2”), a **90° angle** into a pinched fold of skin is standard. Very lean individuals may use **45°** to avoid inadvertently reaching muscle. - **Pinch technique.** With the non-dominant hand, gently pinch a fold of skin and subcutaneous fat. Insert through the pinched fold at the chosen angle, aspirate briefly if your protocol calls for it (not routine for SC peptide injections), inject slowly (over 2–5 seconds), withdraw at the same angle, release the pinch. - **Rotation.** Use different sites across injections — the same-spot-repeatedly pattern leads to local tissue changes (lipohypertrophy, fibrosis) and reduced absorption consistency. ### Intramuscular (IM) Delivery into muscle tissue. Used for peptides where deeper deposition is preferred, for larger volumes, or when absorption kinetics differ meaningfully from SC. - **Sites.** Deltoid (upper arm, 1–2 inches below the acromion), vastus lateralis (outer mid-thigh), ventrogluteal (hip area — generally safer than dorsogluteal). - **Angle.** **90°** straight into the muscle belly, after cleaning the area with an alcohol swab. - **Needle.** Typically 25G × 1” for deltoid in average adults; 1.5” for deeper muscles in larger individuals. - **Technique.** Stretch the skin taut rather than pinching. Insert the needle in one steady motion, inject slowly, withdraw along the same axis. Aspiration (pulling back the plunger briefly to check for blood return) is no longer recommended for most IM sites in contemporary guidance, but some protocols still specify it. ### Intranasal Used for peptides developed for this route — Semax, Selank, oxytocin. These peptides reach the CNS in part via the olfactory and trigeminal nerves, giving them distinct pharmacokinetics from systemic routes. - **Technique.** Tilt head slightly back, spray or drop into each nostril while inhaling gently (not sniffing forcefully — strong inhalation reduces nasal mucosal contact). - **Dose distribution.** Typically split evenly across both nostrils. ### Other routes - **Oral.** Rare in peptide research because most peptides are degraded in the stomach. Exceptions are those with unusual gastric stability (e.g. BPC-157 in rodent studies, oral semaglutide with an absorption enhancer). - **Topical.** GHK-Cu in cosmetics, occasional compounded topicals in dermatologic research. - **Sublingual / buccal.** Limited bioavailability for most peptides but studied in certain research contexts. ## Handling and storage - **Refrigerate reconstituted peptides.** Most peptides are stable at 2–8 °C for weeks once reconstituted; some have shorter windows. Check the peptide-specific guidance. - **Protect from light.** A few peptides (e.g. some GHRH analogs) are photolabile; amber vials or opaque boxes help. - **Do not freeze reconstituted vials.** Freeze-thaw cycles degrade many peptides. - **Label your vials.** Date of reconstitution, concentration (mg/mL), peptide name. Future-you will thank present-you. - **Dispose of sharps responsibly.** Use a sharps container. Do not recap needles — most needle-stick injuries happen during recapping. ## A practical worked example A researcher has a 10 mg vial of a peptide and wants to deliver 250 mcg per dose. 1. **Choose concentration.** At 2 mg/mL, the draw volume is 0.125 mL (12.5 U on an insulin syringe) — a comfortable, measurable volume. 2. **Calculate water.** `10 mg ÷ 2 mg/mL = 5 mL` of bac water to add. 3. **Reconstitute.** Wipe the vial stoppers. Draw 5 mL bac water with a 25G × 1” needle. Insert into the peptide vial at an angle, let the water run down the side of the vial (do not squirt directly onto the powder — this can denature some peptides). Swirl gently. Do not shake. 4. **Wait.** Let the solution sit at room temperature for 1–2 minutes until fully dissolved. Some peptides take longer. 5. **Refrigerate** the reconstituted vial. 6. **Draw and inject.** For each dose, wipe the stopper, draw 12.5 U with an insulin syringe, inject subcutaneously at a new rotation site. ## What this article is and isn’t This is a reference for understanding how peptide research protocols describe reconstitution and injection practices in the literature. It is educational — not a prescription, not a recommendation for administration outside appropriately-authorized research, and not a substitute for guidance from a qualified clinician where medical intervention is involved. --- # Article: How to read peptide research URL: https://peptide-research.org/articles/how-to-read-peptide-research Published: 2026-04-16 Last reviewed: 2026-04-16 Tags: primer, methodology Reading time: ~3 min Summary: A working field guide for critically reading the scientific literature on peptides — what the study type tells you, what "statistically significant" doesn't tell you, and how to spot the signals that a finding is stronger than it looks. If you’re researching a peptide and search PubMed, you’ll find anything from cell-culture experiments to thousand-patient clinical trials, all returned by the same search box. They are not equivalent. This article is a field guide to sorting through what you find. ## The hierarchy of evidence Not all studies carry the same weight. A rough ranking, from weakest to strongest: 1. **In vitro (cell or tissue culture).** A compound does something to isolated cells. Useful for mechanism hypotheses, weak evidence for whole-organism effects. 2. **Animal models** (usually mice or rats). A compound does something to a living organism with roughly human-similar biology. Useful, but many effects seen in rodents fail to replicate in humans. 3. **Phase 1 human trials.** Small (20–80 people), primarily safety and pharmacokinetics. The question is whether humans tolerate it and what happens to it in the body. 4. **Phase 2 human trials.** Medium-sized (100–300 people), first test of efficacy. Effect sizes here should be treated with caution because of small-sample bias. 5. **Phase 3 trials.** Large (often thousands), confirming efficacy and monitoring adverse effects under realistic conditions. 6. **Post-market surveillance and systematic reviews.** The strongest evidence comes from pooling many trials and watching drugs in real-world use over years. A peptide with a striking rodent effect and no human data should excite you about the mechanism and leave you skeptical about claims of human benefit. Rodent-to-human translation is low. ## Who ran the study? Independent replication matters. When the majority of publications on a compound come from a single laboratory or a small collaborative network, the evidence base is more fragile than the raw publication count suggests. Look for: - Studies from multiple independent groups. - Cross-country replication. - Registered trials (with a ClinicalTrials.gov NCT number) rather than retrospective case series. ## What is the outcome being measured? “Significant improvement” can mean very different things. Distinguish: - **Surrogate endpoints**: a biomarker that *should* correlate with a clinical outcome (e.g., HbA1c for diabetes, IGF-1 for GH activity). Useful, but biomarkers sometimes move without the outcome following. - **Clinical endpoints**: something a patient would notice — weight loss, cardiovascular events, survival, quality of life. - **Composite endpoints**: combinations (e.g., “major adverse cardiovascular events”). Check the component results, not just the composite. A peptide that improves a biomarker in a small trial is hypothesis-generating. A peptide that improves a hard clinical endpoint in a large trial is a drug. ## Effect sizes vs. p-values A study can have a statistically significant result that is clinically trivial. Two things to check: - **Absolute effect size.** How much better is the treated group? If weight loss is 2% vs. 1% with placebo, the difference may be real but unimpressive. - **Confidence interval.** A wide 95% CI tells you the effect could be much smaller (or larger) than the point estimate suggests. ## Funding and conflicts The best journals require authors to declare financial relationships. Industry funding doesn’t invalidate findings, but it’s one of several signals to weigh — especially for marginal effect sizes. ## Red flags - Marketing claims not linked to any published study. - Claims referencing “studies” without titles, DOIs, or PMIDs. - Clinical-sounding claims backed only by rodent experiments. - Single-lab evidence with no independent replication over many years. - Trial registrations that were started but never published results. ## Green flags - Pre-registered trial protocols. - Multiple independent replications. - Large, well-powered Phase 3 data. - Findings that survived meta-analysis. - Consistent mechanism across in vitro, animal, and human studies. ## A short rule of thumb If you’re about to believe something about a peptide, ask: *which kind of study showed that, how many people or animals, and has it been independently reproduced?* The three questions take less than a minute to answer and will sharpen almost any claim you encounter. --- # Article: The major peptide categories URL: https://peptide-research.org/articles/peptide-categories-overview Published: 2026-04-16 Last reviewed: 2026-04-16 Tags: primer, overview Reading time: ~3 min Summary: A map of the peptide landscape as we organize it on this site — metabolic, healing and recovery, growth hormone, cognitive, longevity, and blends — with a short note on why each category exists and what its research state looks like. To make a peptide library navigable, peptides have to be grouped somehow. The organizing principle we use on this site is the system each peptide acts on and the research question it has been studied to answer. Here’s a tour of those categories and what to expect from each. ## Metabolic peptides These are peptides that influence glucose handling, appetite, and energy metabolism — most prominently the incretin family (GLP-1, GIP) and their synthetic analogs. **Semaglutide** and **tirzepatide** are the best-studied examples, and also the best-evidenced peptides in any category. Both are FDA-approved, have run through Phase 3 programs for diabetes and weight management, and have follow-on cardiovascular outcomes data. **What to expect from the evidence:** robust, industry-funded trials with large patient numbers, clear clinical endpoints, and active post-market surveillance. The debates are about long-term effects, regulatory supply, and who can access them safely. ## Healing and recovery Peptides in this category are studied for effects on tissue repair, wound healing, tendon and ligament regeneration, and inflammation modulation. **BPC-157** and **TB-500** (a fragment of thymosin β4) are the most-discussed members. **What to expect from the evidence:** nearly entirely preclinical. Most data come from rodent models, and the body of work is heavily concentrated in a small number of laboratories. These compounds are not FDA-approved, and the gap between the rodent literature and what commercial vendors claim is substantial. ## Growth-hormone-related peptides This category includes growth hormone–releasing hormone analogs (sermorelin, CJC-1295) and growth hormone secretagogues (ipamorelin, GHRPs). They act on the pituitary to stimulate GH release, preserving the pulsatile feedback biology rather than introducing exogenous GH. **What to expect from the evidence:** a mixture. Sermorelin has a historical FDA indication (now withdrawn from the US branded market). Others reached Phase 2/3 stages before being discontinued. Mechanism is well-characterized; long-term outcome data at the doses used in grey markets are scarce. All are on the WADA Prohibited List. ## Cognitive peptides This is the most geographically lopsided category. **Semax** and **Selank**, developed in Russia, are registered pharmaceuticals in that country and essentially unknown to Western regulators. **Cerebrolysin** is an Austrian-registered porcine brain extract with decades of mixed evidence in stroke and dementia. **What to expect from the evidence:** large Russian-language clinical literature of variable methodology, sparse English-language peer-reviewed replication, and no FDA-approved status for any of these in the United States. ## Longevity and metabolic-aging peptides This is the newest and most speculative category. **NAD+** (actually a coenzyme, not a peptide), **5-Amino-1MQ** (a small molecule NNMT inhibitor, also not a peptide), and **MOTS-c** (a genuine mitochondrial-derived peptide) fall here. They are grouped because they are marketed together in the longevity-wellness space. **What to expect from the evidence:** primarily preclinical, with a growing body of early human data for oral NAD+ precursors. Claims about “anti-aging” effects in humans rest on extrapolation, not Phase 3 outcome trials. ## Blends Blends — **KLOW**, **GLO**, and others — are not research compounds but vendor-coined product formulations combining several individual peptides. Their constituents vary between sellers. No peer-reviewed pharmacology exists on any blend as a unit; only on its individual components, studied separately. **What to expect from the evidence:** none directly. Reading a blend’s marketing is, strictly, reading claims derived from research on its individual components — combined and extrapolated in ways the original studies don’t support. ## What unites the list Peptides look like a single category because they share a biochemistry (amino acid chains, often bound to specific receptors). In practice, this site covers several very different things: approved pharmaceuticals with Phase 3 data, discontinued pharmaceutical programs, preclinical research compounds, foreign-approved drugs, and vendor marketing labels. Keeping those categories distinct is the first step in reading peptide information carefully. --- # Article: What are peptides? URL: https://peptide-research.org/articles/what-are-peptides Published: 2026-04-16 Last reviewed: 2026-04-16 Tags: primer, biochemistry Reading time: ~3 min Summary: A plain-English primer on what peptides actually are — why the boundary between "peptide" and "protein" is blurrier than the headlines suggest, and why it matters for how these molecules behave in the body. Peptides are short chains of amino acids. That’s the whole definition. The interesting parts are what happens inside that chain and at its edges — because those details determine whether a peptide is a signaling molecule, a structural fragment, a hormone, an antibiotic, or none of the above. ## Amino acids, chains, and bonds Every peptide starts with amino acids — small organic molecules with a specific shape that lets them link together. When two amino acids join, the reaction produces a peptide bond and releases a water molecule. Chain two amino acids, you have a dipeptide. Three, a tripeptide. Longer than that and biology usually calls it a peptide until around 50 residues, at which point it starts being called a protein. That boundary is fuzzy and not biologically meaningful — just a convention. What’s meaningful is the *sequence*. Twenty canonical amino acids mean the number of possible 20-residue sequences is 20²⁰ — more than a million trillion. The sequence determines how the peptide folds, what it binds to, how quickly it’s broken down, and whether it triggers any biological response at all. ## Where peptides come from Peptides come from three general sources: 1. **Natural enzymatic cleavage.** Your body routinely cuts larger proteins into smaller functional fragments. Insulin starts life as a longer precursor. Many hormones (GLP-1, ghrelin, ACTH) are fragments of larger parent proteins. 2. **De novo synthesis.** Ribosomes can produce peptides directly from small genes. Humanin, MOTS-c, and other mitochondrial-derived peptides are examples. 3. **Chemical synthesis in a lab.** Commercial peptide synthesis builds chains one amino acid at a time using automated solid-phase methods. This is how most research and pharmaceutical peptides are manufactured. ## What peptides do Peptides act as signaling molecules. They bind to receptors on cell surfaces — typically G-protein-coupled receptors — or occasionally intracellular targets. Because receptors are picky about shape, small changes in a peptide’s sequence can change what it binds to, how tightly, and for how long. Examples that show the range: - **Insulin** (51 residues): regulates blood glucose. - **Oxytocin** (9 residues): affects smooth muscle contraction and social behavior. - **GLP-1** (~30 residues depending on form): stimulates insulin release and slows gastric emptying. - **Magainin** (23 residues): an antimicrobial peptide found in frog skin. ## Why they’re tricky as drugs Peptides have two features that make them both attractive and difficult as medicines. They are often specific and potent — they can target a receptor that a small molecule can’t reach. But they are also: - **Poorly absorbed by mouth.** Stomach acid and digestive enzymes break most peptides apart before they reach the bloodstream. This is why most peptide drugs are injected. - **Short-lived.** Many peptides have half-lives measured in minutes. Engineering longer half-lives — by modifying sequences, attaching fatty acids, or bolting on polymers — is a major area of pharmaceutical chemistry. - **Expensive to make.** Synthesis costs scale with length and with required purity. ## Why a research-first site matters The word “peptide” covers FDA-approved medicines like semaglutide, unapproved research compounds like BPC-157, and marketing acronyms for vendor blends that are none of the above. Reading *peptide* in a product label tells you almost nothing about whether the molecule is safe, tested, or legal. That’s the work this site is trying to do: separating what the literature actually says from what the marketing says. ---